Recombinant Rat IFN-gamma Protein

Cat. No.: rp186511
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE) See COA
Accession #
P01581
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its ability to inhibit proliferation of L‑929 mouse fibroblast cells. The ED₅₀ for this effect is 8.5 pg/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp186511-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$67.90
50μg
rp186511-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$199.90
100μg
rp186511-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$325.90
1mg
rp186511-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,139.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥95%(SDS-PAGE), See COA ActiBioPure™,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Rat IFN-gamma Protein
Synonyms
IFG | IFI | IFNG | IFNgamma | IFN-gamma | Immune interferon | interferon gamma | interferon, gamma
Grade
ActiBioPure™, Bioactive, Carrier Free, High Performance
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymp
Bioactivity
Measured by its ability to inhibit proliferation of L‑929 mouse fibroblast cells. The ED₅₀ for this effect is 8.5 pg/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
23-156 aa
Sequence
QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC​
Accession #
Predicted molecular weight
29.2 kDa
SDS-PAGE
12.5 kDa, under reducing conditions; 12.7 & 26.8 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Images

Recombinant Rat IFN-gamma Protein (rp186511) - Protein Bioactivity

Measured by its ability to inhibit proliferation of L‑929 mouse fibroblast cells. The ED₅₀ for this effect is 8.5 pg/mL.

Recombinant Rat IFN-gamma Protein (rp186511) - SDS-PAGE
3 μg/lane of Recombinant Rat IFN-gamma Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 12.5 kDa under reducing conditions and 12.7 & 26.8 kDa under non-reducing conditions.
IFNγ has a characteristic domain-swapped dimer structure with two of the six α-helices exchanged with each other. (PMID: 38879015)

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ25F0420953Certificate of AnalysisMar 17, 2026 rp186511
ZJ25F0420954Certificate of AnalysisMar 17, 2026 rp186511
ZJ25F0420955Certificate of AnalysisMar 17, 2026 rp186511
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.