Recombinant Human CNTF Protein

Cat. No.: rp302373
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) See COA
Accession #
P26441
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is typically 4.8 ng/mL in the presence of 1.0 μg/mL Recombinant Human CNTFR alpha Protein (rp169598).
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp302373-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$89.90
50μg
rp302373-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$269.90
100μg
rp302373-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$429.90
1mg
rp302373-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human CNTF Protein
Synonyms
ciliary neurotrophic factor | CNTF | HCNTF
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His-Tag, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
Ciliary neurotrophic factor (CNTF) is a member of the cytokine family. It is a polypeptide hormone that has functions in promoting neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. Its actions appear to be restricted to the
Bioactivity
Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is typically 4.8 ng/mL in the presence of 1.0 μg/mL Recombinant Human CNTFR alpha Protein (rp169598).
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
2-200 aa
Sequence
MNHKVHHHHHHENLYFQSAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Accession #
Predicted molecular weight
25.1 kDa
SDS-PAGE
27.6 kDa, under reducing conditions; 27.6 & 50.2 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human CNTF Protein (rp302373) - Protein Bioactivity
Measured in a cell proliferation assay using TF-1 cells. The ED₅₀ for this effect is typically 4.8 ng/mL in the presence of 1.0 μg/mL Recombinant Human CNTFR alpha Protein (rp169598).
Recombinant Human CNTF Protein (rp302373) - SDS-PAGE 
3 μg/lane of Recombinant Human CNTF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 27.6 kDa under reducing and 27.6 & 50.2 kDa under non-reducing conditions. 
The observation of protein as both dimers and monomers under non-reducing (NR) conditions suggests that a portion of the protein forms dimers. This dimerization may be mediated by (or stabilized by) disulfide bonds (UniProt: P26441).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.