Recombinant Human RWDD1 Protein

Cat. No.: rp192227
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. ≥85%(SDS-PAGE) expressed in E. coli; See COA
Accession #
Q9H446
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp192227-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$139.90
50μg
rp192227-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$399.90
100μg
rp192227-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$629.90
1mg
rp192227-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$4,899.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,≥85%(SDS-PAGE),expressed in E. coli; See COA Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human RWDD1 Protein
Synonyms
DFRP2 | DRG family-regulatory protein 2 | PTD013 | RWD domain containing 1 | RWD domain-containing protein 1 | CGI-24 | RWDD1
Grade
Carrier Free
Specifications & Purity
Carrier Free, ≥85%(SDS-PAGE), expressed in E. coli; See COA
Biochemical and Physiological Mechanisms
RWDD1, also known as CGI-24 or PTD013, belongs to the RWDD1/GIR2 family. This protein protects DRG2 (developmentally regulated GTP binding protein 2), from proteolytic degradation. RWDD1 is a novel RWD domain containing protein. RWD domain refers to three
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
2-243 aa
Sequence
GTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDEDDPDYNPADPESDSAD
Accession #
Predicted molecular weight
27.8 kDa
SDS-PAGE
32.1 kDa; under reducing conditions; 32.2 kDa; under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in E. coli; See COA
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution; it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human RWDD1 Protein (rp192227) - SDS-PAGE 
3 μg/lane of Recombinant Human RWDD1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 32.1 kDa under reducing conditions and 32.2 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0434684Certificate of AnalysisApr 24, 2026 rp192227
ZJ26F0434683Certificate of AnalysisApr 24, 2026 rp192227
ZJ26F0434682Certificate of AnalysisApr 24, 2026 rp192227
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.