GLP-1 (7-37), Agonist of GLP-1 receptor, CAS No.106612-94-6, Agonist of GLP-1 receptor

CAS: 106612-94-6 Cat. No.: G287230 Molecular Weight: 3355.71 PubChem CID: 16133830
AVAILABLE TO ORDER
GRADE & PURITY Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥95%
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
1mg
G287230-1mg
3
$419.90
5mg
G287230-5mg
3
$719.90
10mg
G287230-10mg
2
$1,029.90
25mg
G287230-25mg
3
$1,799.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Moligand™, ≥95% Moligand™ for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 1 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

Specifications

Product Name
GLP-1 (7-37), Agonist of GLP-1 receptor, CAS No.106612-94-6
Synonyms
1450806-98-0 | AKOS025142102 | GLP-1 (7-37) | DTXSID50147676 | GLP-1(7-37) Acetate | GLP-1(7-37) acetate(106612-94-6 free base) | AC-8923 | F92802 | GLP-1 (7-37) peptide | CID 16133830
Grade
Moligand™
Specifications & Purity
Moligand™, ≥95%
Biochemical and Physiological Mechanisms
Endogenous GLP-1 receptor ligand; bioactive and truncated form of GLP-1; insulinotropic hormone.
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Action Type
AGONIST
Mechanism of action
Agonist of GLP-1 receptor
CAS
106612-94-6
Molecule Type
Peptide
Storage and Shipping
Storage
Store at -20°C
Shipped In
Ice chest + Ice pads

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Taxonomic Classification

Taxonomy Tree

KingdomOrganic compounds
SuperclassOrganic Polymers
ClassPolypeptides
SubclassNot available
Intermediate Tree Nodes Not available
Direct ParentPolypeptides
Alternative Parents Peptides  Tyrosine and derivatives  Phenylalanine and derivatives  Arginine and derivatives  Histidine and derivatives  Pentacarboxylic acids and derivatives  Glutamine and derivatives  Glutamic acid and derivatives  Aspartic acid and derivatives  Isoleucine and derivatives  Leucine and derivatives  N-acyl-alpha amino acids  Valine and derivatives  Serine and derivatives  Tryptamines and derivatives  Alpha amino acid amides  Alanine and derivatives  3-alkylindoles  Amphetamines and derivatives  Imidazolyl carboxylic acids and derivatives  1-hydroxy-2-unsubstituted benzenoids  Aralkylamines  Substituted pyrroles  N-acyl amines  Heteroaromatic compounds  Secondary carboxylic acid amides  Secondary alcohols  Amino acids  Primary carboxylic acid amides  Guanidines  Azacyclic compounds  Carboximidamides  Carboxylic acids  Organic oxides  Primary alcohols  Hydrocarbon derivatives  Imines  Carbonyl compounds  Monoalkylamines  
Molecular FrameworkAromatic heteropolycyclic compounds
Substituents Polypeptide - Alpha peptide - Tyrosine or derivatives - Arginine or derivatives - Phenylalanine or derivatives - Pentacarboxylic acid or derivatives - Histidine or derivatives - Glutamic acid or derivatives - Glutamine or derivatives - Isoleucine or derivatives - Aspartic acid or derivatives - Leucine or derivatives - Valine or derivatives - N-acyl-alpha amino acid or derivatives - N-acyl-alpha-amino acid - Alpha-amino acid amide - Triptan - Serine or derivatives - Alanine or derivatives - 3-alkylindole - Alpha-amino acid or derivatives - Amphetamine or derivatives - N-substituted-alpha-amino acid - Indole or derivatives - Indole - Imidazolyl carboxylic acid derivative - 1-hydroxy-2-unsubstituted benzenoid - Aralkylamine - Phenol - Fatty amide - Substituted pyrrole - Fatty acyl - N-acyl-amine - Monocyclic benzene moiety - Benzenoid - Imidazole - Pyrrole - Heteroaromatic compound - Azole - Amino acid or derivatives - Amino acid - Carboxamide group - Guanidine - Secondary carboxylic acid amide - Secondary alcohol - Primary carboxylic acid amide - Azacycle - Carboxylic acid derivative - Carboxylic acid - Organoheterocyclic compound - Carboximidamide - Primary alcohol - Organooxygen compound - Organic oxygen compound - Carbonyl group - Organonitrogen compound - Hydrocarbon derivative - Alcohol - Organic nitrogen compound - Primary amine - Organic oxide - Primary aliphatic amine - Amine - Imine - Aromatic heteropolycyclic compound
DescriptionThis compound belongs to the class of organic compounds known as polypeptides. These are peptides containing ten or more amino acid residues.
External Descriptors Not available
Associated Targets(Human)
GLP1R Tclin Glucagon-like peptide 1 receptor (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

8 results found

Lot NumberCertificate TypeDateItem
G2426112Certificate of AnalysisApr 19, 2024 G287230
G2426113Certificate of AnalysisApr 19, 2024 G287230
G2426114Certificate of AnalysisApr 19, 2024 G287230
G2426115Certificate of AnalysisApr 19, 2024 G287230
G2426147Certificate of AnalysisApr 19, 2024 G287230
G2426148Certificate of AnalysisApr 19, 2024 G287230
G2426162Certificate of AnalysisApr 19, 2024 G287230
G2426163Certificate of AnalysisApr 19, 2024 G287230
Genetic information
Alternate Names1450806-98-0 | AKOS025142102 | GLP-1 (7-37) | DTXSID50147676 | GLP-1(7-37) Acetate | GLP-1(7-37) acetate(106612-94-6 free base) | AC-8923 | F92802 | GLP-1 (7-37) peptide | CID 16133830
Reference
  • 1. Kinetics and inhibition of recombinant human cystathionine gamma-lyase. Toward the rational control of transsulfuration., The Journal of biological chemistry, Steegborn, C C and 7 more authors.
  • 2. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences., Proceedings of the National Academy of Sciences of the United States of America, Strausberg, Robert L RL and 83 more authors.
  • 3. Genomic basis of cystathioninuria (MIM 219500) revealed by multiple mutations in cystathionine gamma-lyase (CTH)., Human genetics, Wang, Jian J and Hegele, Robert A RA.
  • 4. Cloning and nucleotide sequence of human liver cDNA encoding for cystathionine gamma-lyase., Biochemical and biophysical research communications, Lu, Y Y, O'Dowd, B F BF, Orrego, H H and Israel, Y Y.
  • 5. Single nucleotide polymorphism in CTH associated with variation in plasma homocysteine concentration., Clinical genetics, Wang, J J, Huff, A M AM, Spence, J D JD and Hegele, R A RA.
  • 6. Cystathionine gamma-lyase overexpression inhibits cell proliferation via a H2S-dependent modulation of ERK1/2 phosphorylation and p21Cip/WAK-1., The Journal of biological chemistry, Yang, Guangdong G, Cao, Kun K, Wu, Lingyun L and Wang, Rui R.
  • 7. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)., Genome research, Gerhard, Daniela S DS and 115 more authors.
  • 8. Towards a proteome-scale map of the human protein-protein interaction network., Nature, Rual, Jean-François JF and 37 more authors.
  • 9. The DNA sequence and biological annotation of human chromosome 1., Nature, Gregory, S G SG and 178 more authors.
  • 10. Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer., International journal of cancer, Moore, Lee E LE and 14 more authors. more
Documents & Articles
Citations of This Product
References
1. Ekaterina A. Litus, Marina P. Shevelyova, Alisa A. Vologzhannikova, Evgenia I. Deryusheva, Alina V. Chaplygina, Victoria A. Rastrygina, Andrey V. Machulin, Valeria D. Alikova, Aliya A. Nazipova, Maria E. Permyakova, Victor V. Dotsenko, Sergei E. Permyakov, Ekaterina L. Nemashkalova.  (2025)  Interaction Between Glucagon-like Peptide 1 and Its Analogs with Amyloid-β Peptide Affects Its Fibrillation and Cytotoxicity.  INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES,  26  (9): (4095).  [PMID:40362335] [10.3390/ijms26094095]
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Moligand™ grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.