Recombinant Human IL-3 Protein

Cat. No.: rp147546
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. Sterile ? Sterile grade — processed and verified free of viable microorganisms. Use directly in aseptic procedures and cell culture without further sterilization. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥98%(SDS-PAGE&HPLC)
Accession #
P08700
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<10 EU/mg
Bioactivity
Measured in a cell proliferation assay using Human TF-1 cells. The ED50 for this effect is ≤0.1 ng/mL. The corresponding specific activity is>1×10^7 IU/mg.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp147546-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$253.90
50μg
rp147546-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$763.90
100μg
rp147546-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,221.90
1mg
rp147546-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$4,449.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,sterile,PBS Only,≥98%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,PBS Only,Sterile for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IL-3 Protein
Synonyms
Hematopoietic growth factor | IL-3 | Mast cell growth factor | MCGF | Multipotential colony-stimulating factor | P-cell-stimulating factor | Interleukin 3 | Hematopoietic growth factor | IL3 | IL-3 | MGC79398 | interleukin 3 (colony-stimulating factor, mu
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only, Sterile
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, sterile, PBS Only, ≥98%(SDS-PAGE&HPLC)
Biochemical and Physiological Mechanisms
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This C
Bioactivity
Measured in a cell proliferation assay using Human TF-1 cells. The ED50 for this effect is ≤0.1 ng/mL. The corresponding specific activity is>1×10^7 IU/mg.
Endotoxin Concentration
<10 EU/mg
Species
Human
Amino Acids
20-152 aa
Sequence
MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Accession #
Predicted molecular weight
15.1 kDa
SDS-PAGE
15.1 kDa
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
Reconstitute in water to a concentration of 1 mg/mL, for other concentrations, please adjust the concentration of phosphate in the solution by yourself.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃~-80℃ (2 years). Upon delivery aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human IL-3 Protein (rp147546) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is 0.054 ng/mL.

Recombinant Human IL-3 Protein (rp147546) - SDS-PAGE
2 μg/lane of Recombinant Human IL-3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.