Recombinant Human OX40 Ligand/TNFSF4 Protein

Cat. No.: rp181288
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE) See COA
Accession #
P23510
Protein Tag
N-hFc & His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human OX40 Ligand/TNFSF4 Protein (rp181288) at 1.0 μg/mL can bind Amlitelimab (anti-TNFSF4) (Ab190156) with the EC50 of 49.2 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp181288-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$89.90
50μg
rp181288-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$269.90
100μg
rp181288-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$429.90
1mg
rp181288-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,Fc tag,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,Fc tag,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human OX40 Ligand/TNFSF4 Protein
Synonyms
CD134 ligand | CD134L | CD252 antigen | CD252 | Glycoprotein Gp34 | gp34 | OX40 antigen ligand | OX40 Ligand | OX40L | OX-40L | OX4OL | TAX transcriptionally-activated glycoprotein 1 | tax-transcriptionally activated glycoprotein 1 (34kD) | tax-transcript
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, Fc tag, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His-Tag, Fc tag, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
OX-40L, also known as TNFSF4 and CD252, is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. OX-40L is an important costimulatory molecule that plays a crucial role in the regulation of T-cell-mediated immunity. The interaction of
Bioactivity
Immobilized Recombinant Human OX40 Ligand/TNFSF4 Protein (rp181288) at 1.0 μg/mL can bind Amlitelimab (anti-TNFSF4) (Ab190156) with the EC50 of 49.2 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
51-183 aa
Sequence
PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGSSHHHHHHSSGENLYFQGQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Accession #
Predicted molecular weight
45.8 kDa
SDS-PAGE
49.5-56.2 kDa, under reducing conditions; 94.1-108.4 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human OX40 Ligand/TNFSF4 Protein (rp181288) - ELISA 
Immobilized Recombinant Human OX40 Ligand/TNFSF4 Protein (rp181288) at 1.0 μg/mL can bind Amlitelimab (anti-TNFSF4) (Ab190156) with the EC₅₀ of 49.2 ng/mL.
Recombinant Human OX40 Ligand/TNFSF4 Protein (rp181288) - SDS-PAGE
 3 μg/lane of Recombinant Human OX40 Ligand/TNFSF4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 49.5-56.2 kDa under reducing conditions and 94.1-108.4 kDa under non-reducing conditions. Fc fusion proteins can be linked by disulfide bonds in the Fc hinge region to form stable dimers.(PMID: 23665380)

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ25F1230268Certificate of AnalysisDec 19, 2025 rp181288
ZJ25F1230267Certificate of AnalysisDec 19, 2025 rp181288
ZJ25F1230266Certificate of AnalysisDec 19, 2025 rp181288
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.