Recombinant Human PD-L1 Protein

Cat. No.: rp169666
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q9NZQ7
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human PD-L1 Protein (rp169666) at 2.0 μg/mL can bind Sugemalimab (anti-PD-L1) (Ab175662) with the EC50 of 169.70 ng/mL. Immobilized Recombinant Human PD-L1 Protein (rp169666) at 1.0 μg/mL can bind Avelumab (anti-PD-L1) (A412006) with the EC50 of 77.96 ng/mL. Immobilized Recombinant Human PD-L1 Protein (rp169666) at 1.0 μg/mL can bind Envafolimab (anti-PD-L1) (Ab170617) with the EC50 of 339.40 ng/mL. Immobilized Recombinant Human PD-L1 Protein (rp169666) at 1.0 μg/mL can bind Durvalumab (anti-PD-L1) (D412005) with the EC50 of 35.40 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp169666-10μg
≥10
$139.90
50μg
rp169666-50μg
10
$399.90
100μg
rp169666-100μg
10
$579.90
1mg
rp169666-1mg
1
$3,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Programmed death-1 ligand-1 (PD-L1, CD274, B7-H1) has been identified as the ligand for the immunoinhibitory receptor programmed death-1(PD1/PDCD1) and has been demonstrated to play a role in the regulation of immune responses and peripheral tolerance. PD-L1/B7-H1 is a member of the growing B7 family of immune molecules and this protein contains one V-like and one C-like Ig domain within the extracellular domain, and together with PD-L2, are two ligands for PD1 which belongs to the CD28/CTLA4 family expressed on activated lymphoid cells. By binding to PD1 on activated T-cells and B-cells, PD-L1 may inhibit ongoing T-cell responses by inducing apoptosis and arresting cell-cycle progression. Accordingly, it leads to growth of immunogenic tumor growth by increasing apoptosis of antigen specific T cells and may contribute to immune evasion by cancers. PD-L1 thus is regarded as promising therapeutic target for human autoimmune disease and malignant cancers.

Specifications

Product Name
Recombinant Human PD-L1 Protein
Synonyms
B7 H | B7 H1 | B7 homolog 1 | B7-H1 | B7H | B7H1 | CD 274 | CD-274 | CD274 | CD274 antigen | CD274 molecule | MGC142294 | MGC142296 | OTTHUMP00000021029 | PD L1 | PD-L1 | PD1L1_HUMAN | PDCD1 ligand 1 | PDCD1L1 | PDCD1LG1 | PDL 1 | PDL1 | Programmed cell d
Grade
Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactivity
Immobilized Recombinant Human PD-L1 Protein (rp169666) at 2.0 μg/mL can bind Sugemalimab (anti-PD-L1) (Ab175662) with the EC50 of 169.70 ng/mL. Immobilized Recombinant Human PD-L1 Protein (rp169666) at 1.0 μg/mL can bind Avelumab (anti-PD-L1) (A412006) with the EC50 of 77.96 ng/mL. Immobilized Recombinant Human PD-L1 Protein (rp169666) at 1.0 μg/mL can bind Envafolimab (anti-PD-L1) (Ab170617) with the EC50 of 339.40 ng/mL. Immobilized Recombinant Human PD-L1 Protein (rp169666) at 1.0 μg/mL can bind Durvalumab (anti-PD-L1) (D412005) with the EC50 of 35.40 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-239 aa
Sequence
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
26.1 kDa
SDS-PAGE
30.7-37.3 kDa, under reducing conditions; 28.6-36.2 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human PD-L1 Protein (rp169666) - ELISA
Immobilized Recombinant Human PD-L1 Protein (rp169666) at 2.0 μg/mL can bind Sugemalimab (anti-PD-L1) (Ab175662) with the EC₅₀ of 169.70 ng/mL.


Recombinant Human PD-L1 Protein (rp169666) - ELISA
Immobilized Recombinant Human PD-L1 Protein (rp169666) at 1.0 μg/mL can bind Avelumab (anti-PD-L1) (A412006) with the EC₅₀ of 77.96 ng/mL.


Recombinant Human PD-L1 Protein (rp169666) - ELISA
Immobilized Recombinant Human PD-L1 Protein (rp169666) at 1.0 μg/mL can bind Envafolimab (anti-PD-L1) (Ab170617) with the EC₅₀ of 339.40 ng/mL.

Recombinant Human PD-L1 Protein (rp169666) - ELISA
Immobilized Recombinant Human PD-L1 Protein (rp169666) at 1.0 μg/mL can bind Durvalumab (anti-PD-L1) (D412005) with the EC₅₀ of 35.40 ng/mL.

Recombinant Human PD-L1 Protein (rp169666) - SDS-PAGE
3 μg/lane of Recombinant Human PD-L1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 30.7-37.3 kDa under reducing conditions and 28.6-36.2 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0606445Certificate of AnalysisJun 07, 2024 rp169666
ZJ24F0606444Certificate of AnalysisJun 07, 2024 rp169666
ZJ24F0606443Certificate of AnalysisJun 07, 2024 rp169666
ZJ24F0606442Certificate of AnalysisJun 07, 2024 rp169666
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.