Recombinant Human IGFBP6 Protein

Cat. No.: rp222576
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE) expressed in HEK293; See COA
Accession #
P24592
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its ability to inhibit the biological activity of IGF-II (rp147265) on MCF‑7 human breast cancer cells. The ED50 for this effect is 0.62 µg/mL in the presence of 14 ng/mL rhIGF-II.
Size
Status
Price
Qty
10μg
rp222576-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$79.90
50μg
rp222576-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$249.90
100μg
rp222576-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$399.90
1mg
rp222576-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,429.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, ≥90%(SDS-PAGE), expressed in HEK293; See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IGFBP6 Protein
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, ≥90%(SDS-PAGE), expressed in HEK293; See COA
Biochemical and Physiological Mechanisms
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Activates the MAPK si
Bioactivity
Measured by its ability to inhibit the biological activity of IGF-II (rp147265) on MCF‑7 human breast cancer cells. The ED50 for this effect is 0.62 µg/mL in the presence of 14 ng/mL rhIGF-II.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
1-240 aa
Sequence
MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSGHHHHHH
Accession #
Predicted molecular weight
23.4 kDa
SDS-PAGE
26.2-35.0 kDa, under reducing conditions; 26.3-35.0 & 53.4-61.0 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in HEK293; See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human IGFBP6 Protein (rp222576) - Protein Bioactivity 
Measured by its ability to inhibit the biological activity of IGF-II (rp147265) on MCF‑7 human breast cancer cells. The ED50 for this effect is 0.62 µg/mL in the presence of 14 ng/mL rhIGF-II.
Recombinant Human IGFBP6 Protein (rp222576) - SDS-PAGE 
3 μg/lane of Recombinant Human IGFBP6 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 26.2-35.0 kDa under reducing conditions and 26.3-35.0 & 53.4-61.0 kDa under non-reducing conditions. 
Human IGFBP6 Protein can form the dimers through covalent interaction via disulfide bonds under non-reducing conditions (Uniprot: P24592).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.