Recombinant Human AMPK alpha 1 Protein

Cat. No.: rp184863
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE)
Expression System
E. coli
Accession #
Q13131
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Size
Status
Price
Qty
10μg
rp184863-10μg
≥10
$159.90
100μg
rp184863-100μg
7
$799.90
1mg
rp184863-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His-Tag,≥90%(SDS-PAGE) Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Responsible for the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase. It also regulates cholesterol synthesis via phosphorylation and inactivation of hormone-sensitive lipase and hydroxymethylglutaryl-CoA reductase. Appears to act as a metabolic stress-sensing protein kinase switching off biosynthetic pathways when cellular ATP levels are depleted and when 5'-AMP rises in response to fuel limitation and/or hypoxia. This is a catalytic subunit.

Specifications

Product Name
Recombinant Human AMPK alpha 1 Protein
Synonyms
5 AMP activated protein kinase alpha 1catalytic subunit | 5 AMP activated protein kinase catalytic alpha 1 chain | 5' AMP activated protein kinase catalytic subunit alpha 1 | 5'-AMP-activated protein kinase catalytic subunit alpha-1 | AAPK1 | AAPK1_HUMAN
Grade
Carrier Free, His Tag
Specifications & Purity
Carrier Free, His-Tag, ≥90%(SDS-PAGE)
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
349-559 aa
Sequence
MHHHHHHKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
Protein Tag
N-His
Accession #
Predicted molecular weight
24.9 kDa
SDS-PAGE
28.8 & 54.8 kDa, under reducing conditions; 29.6 & 54.5 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human AMPK alpha 1 Protein (rp184863) - SDS-PAGE
3 μg/lane of Recombinant Human AMPK alpha 1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 28.8 & 54.8 kDa under reducing conditions and 29.6 & 54.5 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F0809872Certificate of AnalysisMar 16, 2026 rp184863
ZJ24F0809873Certificate of AnalysisMar 16, 2026 rp184863
ZJ24R0700784Certificate of AnalysisJul 12, 2024 rp184863
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.