Recombinant Human Cathepsin B Protein

Cat. No.: rp183609
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P07858
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human Cathepsin B Protein (rp183609) at 1.0 μg/mL can bind Cathepsin B Mouse mAb (Ab093155) with the EC50 of 163.1 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp183609-10μg
7
$219.90
50μg
rp183609-50μg
4
$639.90
100μg
rp183609-100μg
4
$959.90
1mg
rp183609-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Protein Function:
Cathepsin B is a papain-family cysteine protease that is normally located in lysosomes, where it is involved in the turnover of proteins and plays various roles in maintaining the normal metabolism of cells. This protease has been implicated in pathological conditions, e.g., tumor progression and arthritis. In disease conditions, increases in the expression of cathepsin B occur at both the gene and protein levels. Cathepsin B is synthesized as a preproenzyme and the primary pathways for its normal trafficking to the lysosome utilize mannose 6-phosphate receptors (MPRs). Mature cathepsin B has the ability to degrade several extracellular matrix components at both neutral and acidic pH and has been implicated in the progression of several human and rodent tumors progression and arthritis. Cathepsin B expression is increased in many human cancers at the mRNA, protein and activity levels. It is also frequently overexpressed in premalignant lesions, an observation that associates this protease with local invasive stages of cancer. Increased expression of cathepsin B in primary cancers, and especially in preneoplastic lesions, suggests that this enzyme might have pro-apoptotic features. Active cathepsin B is also secreted from tumours, a mechanism likely to be facilitated by lysosomal exocytosis or extracellular processing by surface activators. Cathepsin B is localized to caveolae on the tumour surface, where binding to the annexin II heterotetramer occurs. Thus CTSB is suggested as a tumor marker. Additionally, Cathepsin B can degrade extracellular matrix proteins, such as collagen IV and laminin, and can activate the precursor form of urokinase plasminogen activator (uPA), perhaps thereby initiating an extracellular proteolytic cascade.

Specifications

Product Name
Recombinant Human Cathepsin B Protein
Synonyms
APPS | Cathepsin B | Cathepsin B1 | CPSBamyloid precursor protein secretase | CTSB | cysteine protease | EC 3.4.22 | EC 3.4.22.1 | APP secretase
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactivity
Immobilized Recombinant Human Cathepsin B Protein (rp183609) at 1.0 μg/mL can bind Cathepsin B Mouse mAb (Ab093155) with the EC50 of 163.1 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-339 aa
Sequence
MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKIHHHHHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
37.3 kDa
SDS-PAGE
40.2-45.0 kDa, under reducing conditions; 37.0-44.0 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human Cathepsin B Protein (rp183609) - ELISA
Immobilized Recombinant Human Cathepsin B Protein (rp183609) at 1.0 μg/mL can bind Cathepsin B Mouse mAb (Ab093155) with the EC50 of 163.1 ng/mL.

Recombinant Human Cathepsin B Protein (rp183609) - SDS-PAGE
3 μg/lane of Recombinant Human Cathepsin B Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 40.2-45.0 kDa under reducing conditions and 37.0-44.0 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0708016Certificate of AnalysisApr 17, 2026 rp183609
ZJ24F0708017Certificate of AnalysisApr 17, 2026 rp183609
ZJ24F0708018Certificate of AnalysisApr 17, 2026 rp183609
ZJ24R0600700Certificate of AnalysisJun 23, 2024 rp183609
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.