Recombinant Human IL-1β Protein

Cat. No.: rp156012
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P01584
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Immobilized Recombinant Human IL-1β Protein (rp156012) at 5.0 μg/mL can bind Recombinant Human IL-1 RII Protein (rp181605) with the EC50 of 176.8 ng/mL. 2. Immobilized Recombinant Human IL-1β Protein (rp156012) at 1.0 μg/mL can bind Gevokizumab (anti-IL-1b) (Ab175856) with the EC50 of 52.68 ng/mL. 3. Immobilized Recombinant Human IL-1β Protein (rp156012) at 1.0 μg/mL can bind Canakinumab (Anti-IL-1b) (Ab170512) with the EC50 of 22.81 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp156012-10μg
≥10
$159.90
50μg
rp156012-50μg
10
$539.90
100μg
rp156012-100μg
10
$939.90
1mg
rp156012-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,499.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Protein Function:
IL-1 is a name that designates two pleiotropic cytokines, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2), which are the products of distinct genes. IL-1 alpha and IL-1 beta are structurally related polypeptides that share approximately 21% amino acid (aa) identity in humans. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. IL-1 RI binds directly to IL-1 alpha or IL-1 beta and then associates with IL-1 R accessory protein (IL-1 R3/IL-1 R AcP) to form a high-affinity receptor complex that is competent for signal transduction. IL-1 RII has high affinity for IL-1 beta but functions as a decoy receptor and negative regulator of IL-1 beta activity. IL-1ra functions as a competitive antagonist by preventing IL-1 alpha and IL-1 beta from interacting with IL-1 RI. The human IL-1 beta cDNA encodes a 269 aa precursor. A 116 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta -converting enzyme (Caspase-1/ICE) to generate the active cytokine. The 17 kDa mature human IL-1 beta shares 96% aa sequence identity with rhesus and 67%-78% with canine, cotton rat, equine, feline, mouse, porcine, and rat IL-1 beta.

Specifications

Product Name
Recombinant Human IL-1β Protein
Synonyms
IL1 beta | IL-1 beta | IL-1 | IL1B | IL-1b | IL1-BETA | IL-1F2 | IL1F2IL-1 beta | interleukin 1, beta | interleukin-1 beta | preinterleukin 1 beta | pro-interleukin-1-beta | catabolin
Grade
ActiBioPure™, Bioactive, Carrier Free, PBS Only
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, PBS Only, ≥95%(SDS-PAGE)
Bioactivity
1. Immobilized Recombinant Human IL-1β Protein (rp156012) at 5.0 μg/mL can bind Recombinant Human IL-1 RII Protein (rp181605) with the EC50 of 176.8 ng/mL. 2. Immobilized Recombinant Human IL-1β Protein (rp156012) at 1.0 μg/mL can bind Gevokizumab (anti-IL-1b) (Ab175856) with the EC50 of 52.68 ng/mL. 3. Immobilized Recombinant Human IL-1β Protein (rp156012) at 1.0 μg/mL can bind Canakinumab (Anti-IL-1b) (Ab170512) with the EC50 of 22.81 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
117-269 aa
Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Protein Tag
No tag
Accession #
Predicted molecular weight
17.4 kDa
SDS-PAGE
15.0 kDa, under reducing conditions; 15.1 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human IL-1β Protein (rp156012) - ELISA
Immobilized Recombinant Human IL-1β Protein (rp156012) at 1.0 μg/mL can bind Gevokizumab (anti-IL-1b) (Ab175856) with the EC₅₀ of 52.68 ng/mL.

Recombinant Human IL-1β Protein (rp156012) - ELISA
Immobilized Recombinant Human IL-1β Protein (rp156012) at 1.0 μg/mL can bind Canakinumab (Anti-IL-1b) (Ab170512) with the EC₅₀ of 22.81 ng/mL.

Recombinant Human IL-1β Protein (rp156012) - SDS-PAGE
3 μg/lane of Recombinant Human IL-1β Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15.0 kDa under reducing conditions and 15.1 kDa under non-reducing conditions.

Recombinant Human IL-1β Protein (rp156012) - Binding Activity
Immobilized Recombinant Human IL-1β Protein (rp156012) at 5.0 μg/mL can bind Recombinant Human IL-1 RII Protein (rp181605) with the EC50 of 176.8 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeDateItem
ZJ25F0927478Certificate of AnalysisJul 12, 2026 rp156012
ZJ25F0927479Certificate of AnalysisJul 12, 2026 rp156012
ZJ24F0707628Certificate of AnalysisFeb 11, 2026 rp156012
ZJ24F0707629Certificate of AnalysisFeb 11, 2026 rp156012
ZJ24F0707630Certificate of AnalysisFeb 11, 2026 rp156012
ZJ24R0600679Certificate of AnalysisJun 14, 2024 rp156012
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.