Recombinant Human IL-36 alpha/IL-1F6 Protein

Cat. No.: rp147571

GRADE & PURITY Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

Q9UHA7

Protein Tag

C-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 4-24 ng/mL.

Overview

Purity
≥95% SDS-PAGE.
Endotoxin level
<1.0 EU/µg
Background:
Human IL-36 alpha, previously called IL-1F6 and FIL1 epsilon (family of IL-1 member epsilon), is a member of the IL-1 family which includes IL-1 beta, IL-1 alpha, IL-1ra, IL-18, and novel family members IL-36 Ra (IL-1F5), IL-36 beta (IL-1F8), IL-36 gamma (IL-1F9), IL-37 (IL-1F7) and IL‑38 (IL‑1F10). All family members show a 12 beta ‑strand, beta -trefoil configuration, and are believed to have arisen from a common ancestral gene. IL-36 alpha is an 18‑22 kDa, 158 amino acid (aa) intracellular and secreted protein that contains no signal sequence, no prosegment and no potential from N‑linked glycosylation sites. It can be released in response to LPS and the cell ATP‑induced activation of the P2X7 receptor. A 120 aa isoform missing aa 1‑38 has been reported. Human IL‑36 alpha (aa 6 ‑ 158) shares 57‑68% aa sequence identity with mouse, rabbit, equine and bovine IL‑36 alpha and 27‑57% aa sequence identity with other novel IL‑1 family members. IL‑36 alpha is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. It is expressed by monocytes, B and T cells. The receptor for IL‑36 alpha is a combination of IL‑1 Rrp2 (also called IL1RL2 or IL‑1 R6), mainly found in epithelia and keratinocytes, and the widely expressed IL‑1 RAcP. IL-36 alpha, beta, and gamma all activate NF-kappa B and MAPK pathways in an IL‑1 Rrp2 dependent manner, and induce production of inflammatory cytokines and chemokines such as CXCL8/IL-8. IL-36 alpha and other family members are overexpressed in psoriatic skin lesions, and transgenic overexpression of IL‑36 alpha in skin keratinocytes produces epidermal hyperplasia. IL-36 alpha is present in kidney tubule epithelia, and it is highly expressed in intubulointerstitial lesions in mouse models of chronic glomerulonephritis, lupus nephritis and diabetic nephritis.

Specifications

Product Name

Recombinant Human IL-36 alpha/IL-1F6 Protein

Synonyms

FIL1 epsilon; FIL1; FIL1(EPSILON); FIL1E; IL-1 epsilon; IL1(EPSILON); IL1E; IL-1E; IL-1F6 (FIL-1-epsilon); IL1F6; IL-1F6; IL36 alpha; IL-36 alpha; IL36A; interleukin 1 family, member 6 (epsilon); interleukin 1, epsilon; Interleukin 36, Alpha; Interleukin-

Grade

ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag

Specifications & Purity

Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥95%(SDS-PAGE)

Bioactivity

Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 4-24 ng/mL.

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Species

Human

Amino Acids

1-158 aa

Sequence

MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLFHHHHHH

Protein Tag

C-His

Accession #

Q9UHA7

Predicted molecular weight

18 kDa

SDS-PAGE

16 kDa, under reducing conditions; 16 kDa, under non-reducing conditions.

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

SDS-PAGE: Recombinant Human IL-36 alpha/IL-1F6 Protein (rp147571)

Recombinant Human IL-36 alpha/IL-1F6 Protein (rp147571) - SDS-PAGE
3 μg/lane of Recombinant Human IL-36 alpha/IL-1F6 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 16 kDa.