Recombinant Human IL-4 Protein

Cat. No.: rp156008
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
P05112
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Recombinant Human IL‑4 Protein (rp156008) stimulates cell proliferation of TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.31 ng/mL.
Size
USA
Germany (EU)*
Price
Qty
10μg
rp156008-10μg
In stock ≥10
$139.90
50μg
rp156008-50μg
In stock ≥10
$399.90
100μg
rp156008-100μg
In stock ≥10
$679.90
1mg
rp156008-1mg
1 In stock
$3,339.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Interleukin-4 (IL-4), also known as B cell-stimulatory factor-1, is a monomeric, approximately 13 kDa‑18 kDa Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four alpha-helix structure. Human IL-4 is synthesized with a 24 aa signal sequence. Alternate splicing generates an isoform with a 16 aa internal deletion. Mature human IL-4 shares 55%, 39%, and 43% aa sequence identity with bovine, mouse, and rat IL-4, respectively. Human, mouse, and rat IL-4 are species-specific in their activities. IL-4 exerts its effects through two receptor complexes. The type I receptor, which is expressed on hematopoietic cells, is a heterodimer of the ligand binding IL-4 R alpha and the common gamma chain (a shared subunit of the receptors for IL-2, -7, -9, -15, and ‑21). The type II receptor on nonhematopoietic cells consists of IL-4 R alpha and IL‑13 R alpha 1. The type II receptor also transduces IL-13 mediated signals. IL-4 is primarily expressed by Th2-biased CD4+ T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG4 and IgE in human B cells, acquisition of the Th2 phenotype by naïve CD4+ T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL-4 plays a dominant role in the development of allergic inflammation and asthma.
Due to its role in the differentiation of certain immune cell types, IL-4 is commonly used in combination with other growth factors to transform induced pluripotent stem cells into dendritic cells in high numbers. These dendritic cells can then be used for research or clinical applications to improve disease modeling, for screening and cell therapies. Study of IL-4 signaling has led to the development of monoclonal antibodies that can block the signaling pathway at various steps to mitigate the inflammatory response in certain autoimmune diseases. While IL-4 has the capacity to improve immune functions, treatments involving IL-4 have not been utilized due to the dangerous side effects that may result from IL-4 signaling in non-immune cells. Blockade of IL-4 signaling also has been studied as a therapeutic target to suppress inflammation in the tumor microenvironment. Use of IL-4 suppressors can also improve the efficacy of anti-tumor immunotherapies, as blocking IL-4 enhances the activity of tumor-specific T lymphocytes.

Specifications

Product Name
Recombinant Human IL-4 Protein
Synonyms
IL4E12 | interleukin 4 | interleukin-4 | Lymphocyte stimulatory factor 1 | MGC79402 | pitrakinra | B cell growth factor 1 | BCDF | B-cell stimulatory factor 1 | BCGF1 | BCGF-1 | binetrakin | BSF1 | BSF-1 | IL4 | IL-4 | IL-4B_cell stimulatory factor 1
Grade
Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Specifications & Purity
Carrier Free,Bioactive,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE)
Bioactivity
Recombinant Human IL‑4 Protein (rp156008) stimulates cell proliferation of TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.31 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
25-153 aa
Sequence
MGSSHHHHHHSSGLVPRGSHMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Protein Tag
N-His
Accession #
Predicted molecular weight
17.2 kDa
SDS-PAGE
15.5 kDa, under reducing condition
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human IL-4 Protein (rp156008) - Protein Bioactivity
Recombinant Human IL‑4 Protein (rp156008) stimulates cell proliferation of TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.31 ng/mL.

Recombinant Human IL-4 Protein (rp156008) - SDS-PAGE
3 μg/lane of Recombinant Human IL-4 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 15.5 kDa under reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeDateItem
ZJ25F1028816Certificate of AnalysisSep 14, 2026 rp156008
ZJ24F0506235Certificate of AnalysisJan 20, 2026 rp156008
ZJ24F0506234Certificate of AnalysisMay 31, 2024 rp156008
ZJ24F0506233Certificate of AnalysisMay 31, 2024 rp156008
ZJ24F0506232Certificate of AnalysisMay 31, 2024 rp156008
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.