Recombinant Mouse Adiponectin/Acrp30 Protein, ＞95% (SDS-PAGE)

Cat. No.: rp153562

GRADE & PURITY Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His Tag, ≥95%(SDS-PAGE)

Expression System

HEK293

Accession #

Q60994

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<0.1 EU/μg

Bioactivity

Measured by its ability to induce TIMP-1 secretion by mouse macrophages. Kumada. The ED₅₀ for this effect is 5-20 μg/mL.

Overview

Purity

>95% SDS-PAGE.

Function

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.

Post-translational

Hydroxylated Lys-33 was not identified in PubMed:16497731, probably due to poor representation of the N-terminal peptide in mass fingerprinting. HMW complexes are more extensively glycosylated than smaller oligomers. Hydroxylation and glycosylation of the lysine residues within the collagene-like domain of adiponectin seem to be critically involved in regulating the formation and/or secretion of HMW complexes and consequently contribute to the insulin-sensitizing activity of adiponectin in hepatocytes. O-glycosylated. Not N-glycosylated. O-linked glycans on hydroxylysines consist of Glc-Gal disaccharides bound to the oxygen atom of post-translationally added hydroxyl groups. Sialylated to varying degrees depending on tissue. Thr-22 appears to be the major site of sialylation. Higher sialylation found in SGBS adipocytes than in HEK fibroblasts. Sialylation is not required neither for heterodimerization nor for secretion. Not sialylated on the glycosylated hydroxylysines. Desialylated forms are rapidly cleared from the circulation.

Specifications

Product Name

Recombinant Mouse Adiponectin/Acrp30 Protein, ＞95% (SDS-PAGE)

Synonyms

ACDC | Acrp30 | ACRP30ADPN | adipocyte, C1Q and collagen domain containing | Adiponectin | adiponectin, C1Q and collagen domain containing | AdipoQ | ADIPQTL1 | ApM1 | apM-1 | APM1APM-1 | C1q and collagen domain-containing protein | GBP28 | GBP28apM1 | Ge

Grade

ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, His Tag

Specifications & Purity

Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His-Tag, ≥95%(SDS-PAGE)

Purity

＞95% (SDS-PAGE)

Bioactivity

Measured by its ability to induce TIMP-1 secretion by mouse macrophages. Kumada. The ED₅₀ for this effect is 5-20 μg/mL.

Endotoxin Concentration

<0.1 EU/μg

Expression System

HEK293

Species

Mouse

Amino Acids

18-247 aa

Sequence

EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNHHHHHH

Protein Tag

C-His

Accession #

Q60994

Predicted molecular weight

25 kDa

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

Reconstitute in water to a concentration of 0.1-1.0 mg/ml.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20~-80℃ for more than 1 year

Images

Protein Bioactivity: Recombinant Mouse Adiponectin/Acrp30 Protein (rp153562)

Recombinant Mouse Adiponectin/Acrp30 Protein (rp153562) - Protein Bioactivity
Fully biologically active determined by the dose dependent increase in MCF7 cell proliferation. The ED₅₀ for this effect is 0.17 μg/mL. Adiponectin induces a dichotomic effect on breast cancer growth. It stimulates growth in ERα+ MCF-7 cells while inhibiting proliferation of ERα- MDA-MB-231 cells.

Protein Bioactivity: Recombinant Mouse Adiponectin/Acrp30 Protein (rp153562)

Recombinant Mouse Adiponectin/Acrp30 Protein (rp153562) - Protein Bioactivity
Measured by its ability to induce TIMP-1 secretion by mouse macrophages. The ED50 for this effect is 5-20 μg/mL.

SDS-PAGE: Recombinant Mouse Adiponectin/Acrp30 Protein (rp153562)

Recombinant Mouse Adiponectin/Acrp30 Protein (rp153562) - SDS-PAGE
4 μg/lane of Recombinant Mouse Adiponectin/Acrp30 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 31.4 kDa under reducing conditions and 30.2 & 54.1 kDa under non-reducing conditions.