Recombinant Human CCL4/MIP-1 beta Protein

Cat. No.: rp170426
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥90%(SDS-PAGE) See COA
Accession #
P13236
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Determined by its ability to chemoattract human blood monocytes using a concentration range of 5.0 - 20.0 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp170426-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$89.90
50μg
rp170426-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$269.90
100μg
rp170426-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$429.90
1mg
rp170426-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,High Performance,≥90%(SDS-PAGE),See COA ActiBioPure™,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human CCL4/MIP-1 beta Protein
Synonyms
Small inducible cytokine A4 | CCL4 | Macrophage inflammatory protein 1-beta | MIP-1- beta | MIP-1-beta(1-69) | T-cell activation protein 2 | ACT-2 | PAT 744 | H400 | SIS-gamma | Lymphocyte activation gene 1 protein | LAG-1 | HC21 | G-26 T-lym
Grade
ActiBioPure™, Bioactive, Carrier Free, High Performance
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥90%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
CCL4 (C-C chemokine ligand 4), is a macrophage inflammatory protein with a chief effect in inflammation and immune-regulation, and was documented in cancer progression by promoting instability in the tumor environment. The inflammatory chemokine (C-C moti
Bioactivity
Determined by its ability to chemoattract human blood monocytes using a concentration range of 5.0 - 20.0 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
24-92 aa
Sequence
SAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Accession #
Predicted molecular weight
7.9 kDa
SDS-PAGE
14.1 & 18.7 kDa, under reducing conditions; 12.3 & 17.8 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human CCL4/MIP-1 beta Protein (rp170426) - SDS-PAGE 
3 μg/lane of Recombinant Human CCL4/MIP-1 beta Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 14.1 & 18.7 kDa under reducing conditions and 12.3 & 17.8 kDa under non-reducing conditions. CCL4/MIP-1 beta Protein belongs to the chemokine family, and these proteins often form dimers or multimers through disulfide bonds (Uniprot ID: P13236).
Recombinant Human CCL4/MIP-1 beta Protein (rp170426) - Protein Bioactivity 
Determined by its ability to chemoattract human blood monocytes using a concentration range of 5.0-20.0 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0131603Certificate of AnalysisJan 28, 2026 rp170426
ZJ26F0131602Certificate of AnalysisJan 28, 2026 rp170426
ZJ26F0131601Certificate of AnalysisJan 28, 2026 rp170426
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.