Recombinant Human CD83 Protein, ＞90%(SDS-PAGE)

Cat. No.: rp144137

GRADE & PURITY Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, ≥90%(SDS-PAGE)

Expression System

HEK293

Accession #

Q01151

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<0.1 EU/μg

Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of human monocyte-derived dendritic cells. When 5 x 104 cells/well are added to human CD83/Fc Chimera coated plates (5 µg/mL, 100 µL/well), approximately 50-75% will adhere after 30 minutes at 37° C.

Overview

Purity:
>90%(SDS-PAGE)

Function:
May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Description:
Human CD83 is a 40 - 50 kDa member of the Siglec (or sialic-acid-binding immunoglobulin-like lectin) family of transmembrane proteins. CD83 is synthesized as a type I transmembrane glycoprotein that contains a 125 amino acid (aa) extracellular region, a 22 aa transmembrane segment, and 39 aa cytoplasmic domain. It contains one V type Ig-like domain in the extracellular region with no inhibitory cytoplasmic motif(s). Although in vitro studies suggest CD83 may form membrane-bound covalent homodimers, in vivo this does not appear to be the case. In the extracellular region, mouse and human CD83 are 66% aa identical. Relative to human, mouse CD83 is 11 aa shorter in its extracellular domain and is expressed as a 30 - 35 kDa protein. Human CD83 is active in the mouse system. One alternate splice form has been reported. This leads to a small monomeric soluble form of 74 aa that includes aa’s # 20 - 52 and # 164 - 205 . In human, proteolytic cleavage and solubilization of CD83 has also been suggested, and this could lead to dimeric circulating CD83. CD83 is a primary marker for dendritic cells. It is also found on B cells, neutrophils, monocytes and macrophages. Except for dendritic cells, CD83 expression is often transient. CD83 binds to sialic acids on target cells. The function of CD83 is only now becoming clear. Membrane CD83 appears to promote T cell proliferation, particularly of CD8+ cytotoxic T cells. Soluble CD83, however, appears to be immunosuppressive and blocks T cell activation. On monocytes, CD83 is suggested to drive monocytes into a fibrocyte phenotype. A lack of membrane-expressed CD83 leads to an unusual IL-4/IL-10 producing CD4+ T cell phenotype.

Specifications

Product Name

Recombinant Human CD83 Protein, ＞90%(SDS-PAGE)

Synonyms

B-cell activation protein | BL11 | BL11CD83 antigen | CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) | CD83 molecule | CD83 | Cell surface protein HB15 | cell-surface glycoprotein | HB15 | HB15hCD83 | B-cell activation protein | Cell s

Grade

ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag

Specifications & Purity

Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥90%(SDS-PAGE)

Purity

＞90%(SDS-PAGE)

Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of human monocyte-derived dendritic cells. When 5 x 104 cells/well are added to human CD83/Fc Chimera coated plates (5 µg/mL, 100 µL/well), approximately 50-75% will adhere after 30 minutes at 37° C.

Endotoxin Concentration

<0.1 EU/μg

Expression System

HEK293

Species

Human

Amino Acids

20-143 aa

Sequence

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAHHHHHH

Protein Tag

C-His

Accession #

Q01151

Predicted molecular weight

14 kDa

SDS-PAGE

18-25 kDa

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is recommended to reconstitute to a concentration of 0.1-1mg/mL. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store it under sterile conditions at -20℃~ -80℃ for more than 1 year.It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles

Images

Protein Bioactivity: Recombinant Human CD83 Protein (rp144137)

Recombinant Human CD83 Protein (rp144137) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of human monocyte-derived dendritic cells. When 5 x 104 cells/well are added to human CD83/Fc Protein coated plates (5 µg/mL, 100 µL/well), approximately 50-75% will adhere after 30 minutes at 37℃.

SDS-PAGE: Recombinant Human CD83 Protein (rp144137)

Recombinant Human CD83 Protein (rp144137) - SDS-PAGE
2 μg/lane of Recombinant Human CD83 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 16.2-27.5 kDa.