Recombinant Human HMGB1 Protein, ＞90% (SDS-PAGE)

Cat. No.: rp156653

GRADE & PURITY Carrier Free, Azide Free, His Tag, PBS Only, ≥90%(SDS-PAGE)

Expression System

E. coli

Accession #

P09429

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Overview

Purity:
>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
High-mobility group box 1 protein (HMGB1), also known as HMG-1 or amphoterin previously, is a member of the HMGB family consisting of three members, HMGB1, HMGB2, and HMGB3. HMGB1 is a DNA-binding nuclear protein, released actively following cytokine stimulation as well as passively during cell death. It is the prototypic damage-associated molecular pattern (DAMP) molecule and has been implicated in several inflammatory disorders. HMGB1 signals via the receptor for advanced glycation end-product (RAGE) and members of the toll-like receptor (TLR) family. The most prominent HMGB1 protein and mRNA expression arthritis are present in pannus regions, where synovial tissue invades articular cartilage and bone. HMGB1 promotes the activity of proteolytic enzymes, and osteoclasts need HMGB1 for functional maturation. As a non-histone nuclear protein, HMGB1 has a dual function. Inside the cell, HMGB1 binds DNA, regulating transcription, and determining chromosomal architecture. Outside the cell, HMGB1 can serve as an alarmin to activate the innate system and mediate a wide range of physiological and pathological responses. Extracellular HMGB1 represents an optimal " necrotic marker" selected by the innate immune system to recognize tissue damage and initiate reparative responses. However, extracellular HMGB1 also acts as a potent pro-inflammatory cytokine that contributes to the pathogenesis of diverse inflammatory and infectious disorders. HMGB1 has been successfully therapeutically targeted in multiple preclinical models of infectious and sterile diseases including arthritis. As shown in studies on patients as well as animal models, HMGB1 can play an important role in the pathogenesis of the rheumatic disease, including rheumatoid arthritis, systemic lupus erythematosus, and polymyositis among others. Besides, enhanced postmyocardial infarction remodeling in type 1 diabetes mellitus was partially mediated by HMGB1 activation.

Specifications

Product Name

Recombinant Human HMGB1 Protein, ＞90% (SDS-PAGE)

Synonyms

Amphoterin | Chromosomal protein | nonhistone | HMG1 | DKFZp686A04236 | High mobility group 1 | High mobility group box 1 | High mobility group protein 1 | High mobility group protein B1 | high-mobility group (nonhistone chromosomal) protein 1 | HMG-1 | H

Grade

Azide Free, Carrier Free, His Tag, PBS Only

Specifications & Purity

Carrier Free, Azide Free, His Tag, PBS Only, ≥90%(SDS-PAGE)

Purity

＞90% (SDS-PAGE)

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Species

Human

Amino Acids

1-215 aa

Sequence

MGHHHHHHMGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Protein Tag

N-His

Accession #

P09429

Predicted molecular weight

25.9 kDa

SDS-PAGE

28.5 kDa

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human HMGB1 Protein (rp156653)

Recombinant Human HMGB1 Protein (rp156653) - SDS-PAGE
3 μg/lane of Recombinant Human HMGB1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 28.5 kDa.