Recombinant Mouse IL-6 Protein, >96%(SDS-PAGE,HPLC)

Cat. No.: rp154236
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥96%(SDS-PAGE&HPLC)
Expression System
E.coli
Accession #
P08505
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured in a cell proliferation assay using M-NFS-60 mouse B cell. The ED₅₀ for this effect is less than 0.4 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp154236-10μg
7
$149.90
50μg
rp154236-50μg
4
$399.90
100μg
rp154236-100μg
1
$683.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥96%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Interleukin-6 (IL-6) encoded by the IL-6 gene, acts as both a pro-inflammatory and anti-inflammatory cytokine. It is secreted by T cells and macrophages to stimulate immune response. IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. It stimulates B cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. Murine IL-6 is inactive on human cells, while both human and murine are equally active on murine cells. Recombinant Murine IL-6 is a 21.7kDa globular protein containing 188 amino acid residues.


Purity

>96%(SDS-PAGE,HPLC)


Function

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. 

Specifications

Product Name
Recombinant Mouse IL-6 Protein, >96%(SDS-PAGE,HPLC)
Synonyms
B-cell differentiation factor | B-cell stimulatory factor 2 | BSF2 | BSF-2 | CDF | CTL differentiation factor | HSF | hybridoma growth factor | IFNB2 | IFN-beta-2 | IL6 | IL-6 | Interferon beta-2 | interleukin 6 (interferon, beta 2) | interleukin BSF-2 |
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Specifications & Purity
ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥96%(SDS-PAGE&HPLC)
Purity
>96%(SDS-PAGE, HPLC)
Bioactivity
Measured in a cell proliferation assay using M-NFS-60 mouse B cell. The ED₅₀ for this effect is less than 0.4 ng/mL.
Endotoxin Concentration
<0.1 EU/μg
Expression System
E.coli
Species
Mouse
Amino Acids
25-211 aa
Sequence
MFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNG NSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYH SYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPIS NALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT
Protein Tag
No tag
N-terminal Sequence
Met
Protein Length
Full length protein
Accession #
Source
Recombinant
Predicted molecular weight
21.7 kDa
Note
This product is about to be sold out and taken down. The replacement product is rp154238
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2、 Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
For long term storage, the product should be stored ≤-20℃. 36 months for -20 to -70℃ as supplied; 1 month for 2 to 8℃ under sterile conditions after reconstitution; 3 months for -20 to -70℃ under sterile conditions after reconstitution. Please avoid rep
Images

Recombinant Mouse IL-6 Protein (rp154236)-Protein Bioactivity
Measured in a cell proliferation assay using M-NFS-60 mouse B cell. The ED₅₀ for this effect is typically <0.4ng/mL.

Recombinant Mouse IL-6 Protein (rp154236)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-6 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 20.1 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

7 results found

Lot NumberCertificate TypeDateItem
ZJ26F0535205Certificate of AnalysisMay 12, 2026 rp154236
ZJ23F0400118Certificate of AnalysisMar 13, 2026 rp154236
ZJ23F0400119Certificate of AnalysisMar 13, 2026 rp154236
ZJ24F0404263Certificate of AnalysisApr 11, 2024 rp154236
ZJ24F0404262Certificate of AnalysisApr 11, 2024 rp154236
ZJ24F0404261Certificate of AnalysisApr 11, 2024 rp154236
ZJ23F0400120Certificate of AnalysisApr 29, 2023 rp154236
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.