Recombinant Bovine CD4 Protein, >90% (SDS-PAGE)

Cat. No.: rp175916
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
F1MJK4
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of NIH‑3T3 mouse embryonic fibroblast cells.The ED50for this effect is 0.1-0.5 μg/mL after a 1 hour incubation at37 °C.Optimal dilutions should be determined by each laboratory for each application.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp175916-10μg
10
$139.90
50μg
rp175916-50μg
2
$299.90
100μg
rp175916-100μg
1
$399.90
1mg
rp175916-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

$2,571.90

$3,198.90
Save $627.00 (19.60%)
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His Tag,PBS Only,≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:> 90%, by SDS-PAGE visualized with Coomassie® Blue Staining.

Description:

CD4, also known as L3T4, T4, and W3/25, is an approximately 55 kDa type I transmembrane glycoprotein that is expressed predominantly on thymocytes and a subset of mature T lymphocytes. It is a standard phenotype marker for the identification of T cell populations. Mature feline CD4 consists of a 388 amino acid (aa) extracellular region containing four immunoglobulin-like domains, a 22 aa transmembrane segment, and a 40 aa cytoplasmic domain. Within the ECD, feline CD4 shares 70%, 58%, 50%, and 48% aa sequence identity with canine, human, mouse and rat CD4, respectively. CD4 is expressed along with CD8 on double positive T cells during their development in the thymus. Either CD4 or CD8 expression is then lost, giving rise to single positive (SP) CD4+ or CD8+ mature T cells. CD4+ SP cells, also known as T helper cells, further differentiate into multiple subsets of CD4+ cells including Th1, Th2, Th17, Tfh, and Treg cells which regulate humoral and cellular immunity. CD4 is reexpressed on circulating CD8+ T cells upon activation and contributes to their cytotoxic effector activity. In human, CD4 is additionally expressed on macrophages, neutrophils, monocytes, NK cells, and neurons and glial cells in the brain. Similar CD4 distribution between species cannot be assumed as demonstrated by its presence on macrophages in human and rat but not in mouse. CD4 binds directly to MHC class II molecules on antigen presenting cells. This interaction contributes to the formation of the immunological synapse which is focused around the TCR-MHC class II-antigenic peptide interaction. Palmitoylation of two cysteine residues in the cytoplasmic tail of CD4 promotes the localization of CD4 in lipid rafts and its ability to augment TCR signaling via activation of the tyrosine kinase Lck. CD4 also functions as a chemotactic receptor for IL-16 and, in human, as a coreceptor for the gp120 surface glycoprotein of HIV-1. 

Specifications

Product Name
Recombinant Bovine CD4 Protein, >90% (SDS-PAGE)
Synonyms
T-cell surface glycoprotein CD4 | T-cell surface antigen T4/Leu-3 | CD4
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, PBS Only, ≥90%(SDS-PAGE)
Purity
>90% (SDS-PAGE)
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of NIH‑3T3 mouse embryonic fibroblast cells.The ED50for this effect is 0.1-0.5 μg/mL after a 1 hour incubation at37 °C.Optimal dilutions should be determined by each laboratory for each application.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-394 aa
Sequence
MGPGTSLRHLFLVLQLAMLPAGTQGKTVVLGEAGDKAELPCQASQKKNMVFSWKDSSQSNILGKRGLFFYKGTTELSHRVESKKNLWDQGSFPLIIKNLQVTDSGTYTCEVDKKTLEVELQVFRLTASSDTHVLLGQSLTLTLESPSGSNPSVQWKGPGDNNKRDVKSLSLAQVGLQDSGTWTCTISQSQQTLEIKIPIVVLAFQKAPETVYVKEGEQAEFSFPLTFEYENLSGELTWQLANGDSSSQSWVTFTVKNREVKVNKIHNDPKLLVGEKLPLRLTLPRTLPQHAGSGTLTLDLTKGKLQQKVKLVVMKVTKSPNSLTCEVLGPSPPKLTLNLKMGNQSMKGSNQPKLVTQPEPQAGMWQCLLSDNGKVLLEAKIEVLPSEFTQAWPKHHHHHH
Protein Tag
C-His
N-terminal Sequence
Ala22
Accession #
Predicted molecular weight
41.6 kDa
SDS-PAGE
38.8-53.9 kDa, under reducing conditions; 37.1-51.0 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Bovine CD4 Protein (rp175916) - SDS-PAGE
3 μg/lane of Recombinant Bovine CD4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 38.8-53.9 kDa under reducing conditions and 37.1-51.0 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F0505229Certificate of AnalysisDec 15, 2025 rp175916
ZJ24F0505230Certificate of AnalysisDec 15, 2025 rp175916
ZJ24F0505231Certificate of AnalysisDec 15, 2025 rp175916
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.