Recombinant Human Caveolin-1 Protein

Cat. No.: rp183730
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q03135
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp183730-10μg
≥10
$159.90
100μg
rp183730-100μg
≥10
$499.90
1mg
rp183730-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,799.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free, ≥95%(SDS-PAGE) Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Caveolin-1 is a palmitoylated 22 kDa membrane-associated protein in caveolae, the cholesterol-rich invaginations in the plasma membrane involved in vesicular transport and regulation of lipid rafts. Caveolin-1 expression is dysregulated during cancer progression and exhibits both positive and negative effects on tumor progression. The central region of Caveolin-1 (aa 105‑125) is buried in the lipid layer, while the N- and C-terminal flanking regions are exposed to the cytoplasm and interact with many other proteins. Within these cytoplasmic regions, human Caveolin-1 shares 95% aa sequence identity with mouse and rat Caveolin-1. Alternate splicing in human, mouse and rat generates an isoform with a deletion of the N-terminal 31 residues.

Specifications

Product Name
Recombinant Human Caveolin-1 Protein
Synonyms
CAV | CAV1 | caveolae protein, 22kD | caveolin 1, caveolae protein, 22kDa | Caveolin1 | Caveolin-1 | cell growth-inhibiting protein 32 | MSTP085 | VIP21
Grade
Carrier Free
Specifications & Purity
Carrier Free, ≥95%(SDS-PAGE)
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
2-80 aa
Sequence
SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHS
Protein Tag
No tag
Accession #
Predicted molecular weight
8.9 kDa
SDS-PAGE
13.0 kDa, under reducing conditions; 13.0 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human Caveolin-1 Protein(rp183730) - SDS-PAGE
3 μg/lane of Recombinant Human Caveolin-1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 13.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F0708011Certificate of AnalysisFeb 24, 2026 rp183730
ZJ24F0708012Certificate of AnalysisFeb 24, 2026 rp183730
ZJ24R0500613Certificate of AnalysisJun 02, 2024 rp183730
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.