Recombinant Human IL-6 Protein, >95% SDS-PAGE

Cat. No.: rp147615
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E.coli
Accession #
P05231
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is typically less than 0.6 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp147615-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$143.90
25μg
rp147615-25μg
3
$213.90
100μg
rp147615-100μg
1
$755.90
1mg
rp147615-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,773.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity

>95% SDS-PAGE. Protein Content and Purity (typically = 95%) determined by reducing and Non-reducing SDS-PAGE, UV spectroscopy at 280 nm.

Additional sequence information

This product is for the mature full length protein. The signal peptide is not included.

Function

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.

Post-translational:N- and O-glycosylated.

Specifications

Product Name
Recombinant Human IL-6 Protein, >95% SDS-PAGE
Synonyms
B-cell differentiation factor | B-cell stimulatory factor 2 | BSF2 | BSF-2 | CDF | CTL differentiation factor | HSF | hybridoma growth factor | IFNB2 | IFN-beta-2 | IL6 | IL-6 | Interferon beta-2 | interleukin 6 (interferon, beta 2) | interleukin BSF-2 |
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induc
Purity
>95% SDS-PAGE
Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is typically less than 0.6 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E.coli
Species
Human
Amino Acids
29-212 aa
Sequence
PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Protein Tag
No tag
Accession #
Predicted molecular weight
20.9 kDa
SDS-PAGE
20.6 kDa, under reducing conditions; 20.6 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
After receiving lyophilized powder protein, centrifuge first, and reconstitute at 100ug/mL in sterile PBS.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Stable for 12 months from the date of receipt of the product under proper storage andhandling conditions. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human IL-6 Protein (rp147615) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically less than 0.6 ng/mL.

Recombinant Human IL-6 Protein (rp147615) - SDS-PAGE
2 μg/lane of Recombinant Human IL-6 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 20.6 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ23F1101727Certificate of AnalysisMay 19, 2026 rp147615
ZJ23F1101728Certificate of AnalysisMay 19, 2026 rp147615
ZJ23F0800893Certificate of AnalysisDec 16, 2025 rp147615
ZJ23F0800894Certificate of AnalysisDec 16, 2025 rp147615
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.