Recombinant Human CD24 Protein

Cat. No.: rp181203
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Accession #
P25063
Protein Tag
C-hFc
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
Size
USA
Germany (EU)*
Price
Qty
10μg
rp181203-10μg
In stock ≥10
$139.90
50μg
rp181203-50μg
In stock ≥10
$339.90
100μg
rp181203-100μg
In stock ≥10
$599.90
1mg
rp181203-1mg
US Made to order · 2–4 wks ·
$3,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Fc tag,PBS Only,≥90%(SDS-PAGE) Animal Free,Carrier Free,Fc tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity: ≥90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. Cluster of differentiation 24, also known as signal transducer CD24 or heat stable antigen CD24 (HSA), is a mucin-type glycosylphosphatidylinositol-linked glycoprotein expressed on the surface of B-cells, differentiating neuroblasts and many tumors. It is involved in molecular adhesion and metastatic tumor spread and serve as a normal receptor for P-selectin. The CD24 / P-selectin pathway could be important in disseminating tumor cells by facilitating the interaction with platelet and endothelial cells. It has also been considered as a tumor marker. High rate of CD24 expressions have been found in epithelial ovarian cancer, breast cancer, non-small cell lung cancer, prostate cancer and pancreatic cancer.

Specifications

Product Name
Recombinant Human CD24 Protein
Synonyms
CD 24 | CD24 antigen (small cell lung carcinoma cluster 4 antigen) | CD24 antigen | CD24 molecule | CD24 | CD24A | CD24Asignal transducer CD24 | FLJ22950 | FLJ43543 | MGC75043 | Small cell lung carcinoma cluster 4 antigen
Grade
Animal Free, Carrier Free, Fc tag, PBS Only
Specifications & Purity
Animal Free,Carrier Free,Fc tag,PBS Only,≥90%(SDS-PAGE)
Bioactivity
Testing in progress
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-59 aa
Sequence
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK​
Protein Tag
C-hFc
Accession #
Predicted molecular weight
28.9 kDa
SDS-PAGE
39.7-51.4 kDa, under reducing conditions; 39.7-51.4 & 91.2-106.7 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human CD24 Protein (rp181203) - SDS-PAGE
3 μg/lane of Recombinant Human CD24 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 39.7-51.4 kDa under reducing conditions and 39.7-51.4 kDa & 91.2-106.7 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F0606487Certificate of AnalysisJun 07, 2024 rp181203
ZJ24F0606486Certificate of AnalysisJun 07, 2024 rp181203
ZJ24F0606485Certificate of AnalysisJun 07, 2024 rp181203
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.