Recombinant Human CD28 Protein

Cat. No.: rp301926
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
P10747
Protein Tag
No tag
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human CD28 Protein (rp301926) at 1.0 μg/mL can bind Theralizumab (anti-CD28) (Ab190136) with the EC50 of 311.2 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp301926-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$59.90
50μg
rp301926-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$149.90
100μg
rp301926-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$239.90
1mg
rp301926-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,499.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human CD28 Protein
Synonyms
CD28 | CD28 antigen | CD28 molecule | T-cell-specific surface glycoprotein CD28 | Tp44
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, PBS Only, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
CD28 and CTLA-4, together with their ligands, B7-1 and B7-2, constitute one of the dominant co-stimulatory pathways that regulate T and B cell responses. CD28 and CTLA-4 are structurally homologous molecules that are members of the immunoglobulin (Ig) gen
Bioactivity
Immobilized Recombinant Human CD28 Protein (rp301926) at 1.0 μg/mL can bind Theralizumab (anti-CD28) (Ab190136) with the EC50 of 311.2 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
1-152 aa
Sequence
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPENLYFQ
Accession #
Predicted molecular weight
17.9 kDa
SDS-PAGE
36.3-46.5 kDa, under reducing conditions; 60.5-74.8 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human CD28 Protein (rp301926) - ELISA
 Immobilized Recombinant Human CD28 Protein (rp301926) at 1.0 μg/mL can bind Theralizumab (anti-CD28) (Ab190136) with the EC₅₀ of 311.2 ng/mL.
Recombinant Human CD28 Protein (rp301926) - SDS-PAGE 
3 μg/lane of Recombinant Human CD28 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 36.3-46.5 kDa under reducing conditions and 60.5-74.8 kDa under non-reducing conditions. CD28 can form homodimers through disulfide bonds (PMID: 35397202).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.