Recombinant Human CD79B Protein

Cat. No.: rp176729
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
P40259
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab (anti-CD79b) (Ab175715) with the EC50 of 11.08 ng/mL. 2. Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab vedotin-piiq (anti-CD79b) (Ab175635) with the EC50 of 51.95 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp176729-10μg
7
$89.90
50μg
rp176729-50μg
3
$265.90
100μg
rp176729-100μg
1
$439.90
1mg
rp176729-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,079.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.

Specifications

Product Name
Recombinant Human CD79B Protein
Synonyms
B cell antigen receptor complex associated protein beta chain | B cell specific glycoprotein B29 | B-cell antigen receptor complex-associated protein beta chain | B-cell-specific glycoprotein B29 | B29 | B29/Ig-beta/CD79b | CD 79b | CD79b | CD79b antigen
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥90%(SDS-PAGE)
Bioactivity
1. Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab (anti-CD79b) (Ab175715) with the EC50 of 11.08 ng/mL. 2. Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab vedotin-piiq (anti-CD79b) (Ab175635) with the EC50 of 51.95 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-159 aa
Sequence
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDHHHHHH
Protein Tag
C-His
N-terminal Sequence
Ala29
Accession #
Predicted molecular weight
16.0 kDa
SDS-PAGE
26.8-38.0 kDa, under reducing conditions; 28.8-34.6 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human CD79B Protein (rp176729) - ELISA
Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab (anti-CD79b) (Ab175715) with the EC₅₀ of 11.08 ng/mL.

Recombinant Human CD79B Protein (rp176729) - ELISA
Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab vedotin-piiq (anti-CD79b) (Ab175635) with the EC₅₀ of 51.95 ng/mL.

Recombinant Human CD79B Protein (rp176729) - SDS-PAGE
3 μg/lane of Recombinant Human CD79B Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.8-38.0 kDa under reducing conditions and 28.8-34.6 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0708338Certificate of AnalysisFeb 11, 2026 rp176729
ZJ24F0708339Certificate of AnalysisFeb 11, 2026 rp176729
ZJ24F0708340Certificate of AnalysisFeb 11, 2026 rp176729
ZJ24R0700768Certificate of AnalysisJul 06, 2024 rp176729
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.