Recombinant Human Fc gamma RIIIA/CD16a Protein

Cat. No.: rp169611
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P08637
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp169611-10μg
4
$119.90
50μg
rp169611-50μg
2
$319.90
100μg
rp169611-100μg
1
$519.90
1mg
rp169611-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,399.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Protein Function::
The Fc receptor with low affinity for IgG (FCGR3, or CD16) is encoded by 2 nearly identical genes, FCGR3A and FCGR3B, resulting in tissue-specific expression of alternative membrane-anchored isoforms. FCGR3A, it is also known as CD16a, encodes a transmembrane protein expressed on activated monocytes/macrophages, natural killer (NK) cells, and a subset of T cells. CD16a / FCGR3A is a receptor expressed on NK cells that facilitates antibody dependent cellular cytotoxicity (ADCC) by binding to the Fc portion of various antibodies. CD16a / FCGR3A also has a broader function. CD16a / FCGR3A is directly involved in the lysis of some virus-infected cells and tumor cells by NK cells, independent of antibody binding. Cross-linking of CD16a / FCGR3A on NK cells resulted in increased intracellular Ca2+ levels and a cascade of biochemical events similar to those activated by the T cell receptor. CD16a / FCGR3A on human NK cells is a lysis receptor that mediates the direct killing of some virus infected and tumor cells, independent of antibody ligation.

Specifications

Product Name
Recombinant Human Fc gamma RIIIA/CD16a Protein
Synonyms
CD16a | CD16FCRIIIA | Fc fragment of IgG, low affinity IIIa, receptor (CD16a) | Fc fragment of IgG, low affinity IIIa, receptor for (CD16) | Fc gamma receptor III-A | Fc gamma RIIIA | FCG3 | Fc-gamma receptor III-2 (CD 16) | Fc-gamma receptor IIIb (CD16)
Grade
Animal Free, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactivity
Testing in progress
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-208 aa
Sequence
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
22.7 kDa
SDS-PAGE
35.0-55.0 kDa, under reducing conditions; 35.0-55.0 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human Fc gamma RIIIA/CD16a Protein (rp169611) - SDS-PAGE
3 μg/lane of Recombinant Human Fc gamma RIIIA/CD16a Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 35.0-55.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

7 results found

Lot NumberCertificate TypeDateItem
ZJ25F0521956Certificate of AnalysisMar 16, 2026 rp169611
ZJ25F0521957Certificate of AnalysisMar 16, 2026 rp169611
ZJ25F0521958Certificate of AnalysisMar 16, 2026 rp169611
ZJ24F0708466Certificate of AnalysisFeb 11, 2026 rp169611
ZJ24F0708467Certificate of AnalysisFeb 11, 2026 rp169611
ZJ24F0708468Certificate of AnalysisFeb 11, 2026 rp169611
ZJ24R0700765Certificate of AnalysisJul 06, 2024 rp169611
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.