Recombinant Human GTPase HRAS Protein, >95% (SDS-PAGE)

Cat. No.: rp170121
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P01112
Protein Tag
N-His
Expression system
E. coli
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp170121-10μg
≥10
$127.90
100μg
rp170121-100μg
8
$759.90
1mg
rp170121-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$4,799.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Azide Free,His-Tag,≥95%(SDS-PAGE) Azide Free,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
HRas, also known as HRAS, belongs to the small GTPase superfamily, Ras family, and is widely expressed. It functions in signal transduction pathways. HRas can bind GTP and GDP, and they have intrinsic GTPase activity. It undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Defects in HRAS are the cause of faciocutaneoskeletal syndrome (FCSS). FCSS is a rare condition characterized by prenatally increased growth, postnatal growth deficiency, mental retardation, distinctive facial appearance, cardiovascular abnormalities, tumor predisposition, skin, and musculoskeletal abnormalities. Defects in HRAS also can cause congenital myopathy with excess of muscle spindles. HRAS deficiency may be a cause of susceptibility to Hurthle cell thyroid carcinoma. It has been shown that defects in HRAS can cause susceptibility to bladder cancer which is a malignancy originating in tissues of the urinary bladder. It often presents with multiple tumors appearing at different times and different sites in the bladder. Most bladder cancers are transitional cell carcinomas. They begin in cells that normally make up the inner lining of the bladder. Other types of bladder cancer include squamous cell carcinoma (cancer that begins in thin, flat cells) and adenocarcinoma (cancer that begins in cells that make and release mucus and other fluids). Bladder cancer is a complex disorder with both genetic and environmental influences. Defects in HRAS are the cause of oral squamous cell carcinoma.

Specifications

Product Name
Recombinant Human GTPase HRAS Protein, >95% (SDS-PAGE)
Synonyms
c-H-ras | EC 3.6.5.2 | Ha-Ras | H-Ras-1 | p21ras | Transforming protein p21 | c-H-ras | CBAS/HAS | CHARAS1 | cHras | CTLO | GTPase HRas | H-Ras-1 | Ha-Ras | HAMSV | HaRas | HRAS | HRas1 | HRASIDX | KRAS | N-terminally processed | NRAS | p21ras | RASH_HUMA
Grade
Azide Free, Carrier Free, His Tag
Specifications & Purity
Carrier Free, Azide Free, His-Tag, ≥95%(SDS-PAGE)
Purity
>95% (SDS-PAGE)
Expression System
E. coli
Amino Acids
2-186 aa
Sequence
MHHHHHHTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC
Protein Tag
N-His
Accession #
Predicted molecular weight
21.8 kDa
SDS-PAGE
22.4 kDa, under reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human GTPase HRAS Protein (rp170121) - SDS-PAGE
3 μg/lane of Recombinant Human GTPase HRAS Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 22.4 kDa under reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeDateItem
ZJ24F0102697Certificate of AnalysisJun 18, 2026 rp170121
ZJ24F0102698Certificate of AnalysisJun 18, 2026 rp170121
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View Azide Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.