Recombinant Human p27 KIP 1 Protein, >95% SDS-PAGE

Cat. No.: rp176706
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P46527
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp176706-10μg
≥10
$111.90
100μg
rp176706-100μg
≥10
$527.90
1mg
rp176706-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,399.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) Azide Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Cyclin-Dependent Kinase Inhibitor 1B (CDKN1B) is a Kinesin-related motor protein necessary for mitotic spindle assembly and chromosome segregation. CDKN1B is expressed in all tissues with highest levels observed in skeletal muscle. CDKN1B is a potent inhibitor of Cyclin E- and Cyclin A-CDK2 complexes. CDKN1B forms a complex with Cyclin Type D-CDK4 complexes and is involved in the assembly, stability, and modulation of CCND1-CDK4 complex activation. In addition, CDKN1B acts as an inhibitor or an activator of Cyclin Type D-CDK4 complexes depending on its phosphorylation state and stoichometry.

Specifications

Product Name
Recombinant Human p27 KIP 1 Protein, >95% SDS-PAGE
Synonyms
Cyclin-dependent kinase inhibitor 1B | Cyclin-dependent kinase inhibitor p27 | p27Kip1 | AA408329 | AI843786 | Cdki1b | CDKN 1B | CDKN 4 | CDKN1B | CDKN4 | CDN1B_HUMAN | Cyclin Dependent Kinase Inhibitor 1B | Cyclin dependent kinase inhibitor p27 | Cyclin
Grade
Azide Free, Carrier Free, His Tag, PBS Only
Specifications & Purity
Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Purity
>95% SDS-PAGE
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
1-198 aa
Sequence
MGSSHHHHHHSSGLVPRGSHMSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Protein Tag
N-His
Accession #
Predicted molecular weight
24.2 kDa
SDS-PAGE
29.7 kDa, reducing conditions; 26.7 and 29.4 kDa,non-reducing condition
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human p27 KIP 1 Protein (rp176706) - SDS-PAGE
3 μg/lane of Recombinant Human p27 KIP 1 Protein was resolved with SDS-PAGE under reducing (R) visualized by Coomassie® Blue staining, showing a band at 29.7 kDa under reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F0102359Certificate of AnalysisJun 18, 2026 rp176706
ZJ24F0102360Certificate of AnalysisJun 18, 2026 rp176706
ZJ24F0102361Certificate of AnalysisJun 18, 2026 rp176706
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.