Recombinant Human VEGF 165 Protein

Cat. No.: rp166633
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. Sterile ? Sterile grade — processed and verified free of viable microorganisms. Use directly in aseptic procedures and cell culture without further sterilization. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥98%(SDS-PAGE)
Accession #
P15692-4
Protein Tag
C-His
Expression system
CHO
Endotoxin Concentration
<10 EU/mg
Bioactivity
Measured in a cell proliferation assay using Human HUVEC cells. The ED50 for this effect is <2 ng/mL. The corresponding specific activity is>1×10^6 IU/mg.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp166633-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$379.90
50μg
rp166633-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,119.90
100μg
rp166633-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,679.90
1mg
rp166633-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$7,399.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,sterile,His Tag,PBS Only,≥98%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only,Sterile for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human VEGF 165 Protein
Synonyms
Vascular Endothelial Growth Factor | MVCD1 | VAS | vascular endothelial growth factor A | Vascular permeability factor | Vasculotropin | VEGF | VEGFA | VEGF-A | MGC70609 | VPF | VPFvascular endothelial growth factor | L-VEGF | VEGF165
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only, Sterile
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, sterile, His Tag, PBS Only, ≥98%(SDS-PAGE)
Biochemical and Physiological Mechanisms
N-VEGF: Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A.Involved in protecting cells from hypoxia-mediated cell death (By similarity). VEGFA: Growth factor active in angioge
Bioactivity
Measured in a cell proliferation assay using Human HUVEC cells. The ED50 for this effect is <2 ng/mL. The corresponding specific activity is>1×10^6 IU/mg.
Endotoxin Concentration
<10 EU/mg
Amino Acids
27-191 aa
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRHHHHHH
Accession #
Predicted molecular weight
20 kDa
SDS-PAGE
38.2 kDa
Molecule Type
Protein
Storage and Shipping
Reconstitution
Reconstitute in water to a concentration of 1 mg/mL, for other concentrations, please adjust the concentration of phosphate in the solution by yourself.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃~-80℃ (2 years). Upon delivery aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human VEGF 165 Protein (rp166633) - Protein Bioactivity
Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 1.7 ng/mL.

Recombinant Human VEGF 165 Protein (rp166633) - SDS-PAGE
2 μg/lane of Recombinant Human VEGF 165 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 25 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.