Recombinant GFP Protein, >95% (SDS-PAGE)

Cat. No.: rp156636
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. Em:510nm ? Fluorescence emission maximum at 510 nm — the wavelength this fluorophore emits after excitation. Use it to pick the right detection filter and avoid channel cross-talk. Ex:488nm ? Fluorescence excitation maximum at 488 nm — the wavelength of light that best excites this fluorophore. Match it to your instrument's laser or filter set for the strongest signal. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P42212
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp156636-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$93.90
50μg
rp156636-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$279.90
100μg
rp156636-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$499.90
1mg
rp156636-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,499.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Azide Free,Em:510nm,Ex:488nm,His Tag,PBS Only,≥95%(SDS-PAGE) Azide Free,Carrier Free,Em:510nm,Ex:488nm,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
The green fluorescent protein (GFP) is a protein that exhibit bright green fluorescence when exposed to blue light. GFPSparkTM is an improved variant of the green fluorescent protein GFP. It possesses bright green fluorescence (excitation/ emission max = 487 / 508 nm) that is visible earlier than fluorescence of other green fluorescent proteins. GFPSparkTM is mainly intended for applications where fast appearance of bright fluorescence is crucial. Its amazing ability to generate a highly visible, efficiently emitting internal fluorophore is both intrinsically fascinating and tremendously valuable. It is specially recommended for cell and organelle labeling and tracking the promoter activity.

Specifications

Product Name
Recombinant GFP Protein, >95% (SDS-PAGE)
Synonyms
GFP | Green fluorescent protein | Aequorea victoria | GFP/SNAP25B/VAMP-2 | SNAP25B/VAMP-2
Grade
Azide Free, Carrier Free, Em:510nm, Ex:488nm, His Tag, PBS Only
Specifications & Purity
Carrier Free, Azide Free, Em:510nm, Ex:488nm, His Tag, PBS Only, ≥95%(SDS-PAGE)
Purity
>95% (SDS-PAGE)
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Species
Aequorea victoria
Amino Acids
1-238 aa
Sequence
MGHHHHHHMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Protein Tag
N-His
Ex/Em(nm)
Accession #
Predicted molecular weight
27.9 kDa
SDS-PAGE
27.9 kDa
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.
Images

Recombinant GFP Protein (rp156636) - SDS-PAGE
3 μg/lane of Recombinant GFP Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 27.9 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeDateItem
ZJ25F0825135Certificate of AnalysisJun 22, 2026 rp156636
ZJ25F0825136Certificate of AnalysisJun 22, 2026 rp156636
ZJ25F0825137Certificate of AnalysisJun 22, 2026 rp156636
ZJ23F0700565Certificate of AnalysisJul 14, 2023 rp156636
ZJ23F0700566Certificate of AnalysisJul 14, 2023 rp156636
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.