Recombinant Human IL-17A Protein

Cat. No.: rp147421
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE)
Accession #
Q16552
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 3.9 ng/mL.
Size
USA
Germany (EU)*
Price
Qty
10μg
rp147421-10μg
5 In stock
$139.90
50μg
rp147421-50μg
2 In stock
$409.90
1mg
rp147421-1mg
US Made to order · 2–4 wks ·
$4,899.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

来源:Abcam70313 ;序列为全序列

Specifications

Product Name
Recombinant Human IL-17A Protein
Synonyms
CTLA-8 | Cytotoxic T-lymphocyte-associated antigen 8 | IL-17 | IL-17A | CTLA8 | CTLA-8 | cytotoxic T-lymphocyte-associated serine esterase 8 | Cytotoxic T-lymphocyte-associated antigen 8 | IL17 | IL-17 | IL17A | IL-17A | Acytotoxic T-lymphocyte-associated
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥90%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with
Bioactivity
Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 3.9 ng/mL.
Endotoxin Concentration
<0.1 EU/μg
Species
Human
Amino Acids
24-155 aa
Sequence
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH
Accession #
Predicted molecular weight
16 kDa
SDS-PAGE
18-25 kDa,under reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Liquid
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20~-80℃ long term (1 year). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human IL-17A Protein (rp147421) - ELISA 
Immobilized Recombinant Human IL-17A Protein (rp147421) at 1 μg/mL can bind Vunakizumab (anti-IL-17a) (Ab175703) with the EC50 of 156.5 ng/mL.
Recombinant Human IL-17A Protein (rp147421) - SDS-PAGE 
2 μg/lane of Recombinant Human IL-17A Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. As a result of different glycosylation, it migrates as approximately 16 - 21 kDa band in SDS-PAGE under reducing conditions and 16 - 21 & 28 - 39 kDa under non-reducing condition.
Recombinant Mouse CTLA-4 Protein (rp153837) - Protein Bioactivity
 Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 3.9 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Associated Targets(Human)
IL17A Tclin Interleukin-17A (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ25F1129299Certificate of AnalysisNov 07, 2025 rp147421
ZJ25F1129298Certificate of AnalysisNov 07, 2025 rp147421
ZJ25F1129297Certificate of AnalysisNov 07, 2025 rp147421
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.