Recombinant Human IL-6 Protein, >95% (SDS-PAGE)

Cat. No.: rp156005

GRADE & PURITY Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

P05231

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.123 ng/mL. Immobilized Recombinant Human IL-6 Protein (rp156005) at 1.0 μg/mL can bind MEDI-5117 (anti-IL-6) (Ab182698) with the EC50 of 13.84 ng/mL.

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Interleukin-6 (IL-6) is a pleiotropic, alpha-helical, 22-28 kDa phosphorylated and variably glycosylated cytokine that plays important roles in the acute phase reaction, inflammation, hematopoiesis, bone metabolism, and cancer progression. Mature human IL-6 is 183 amino acids (aa) in length and shares 39% aa sequence identity with mouse and rat IL-6. Alternative splicing generates several isoforms with internal deletions, some of which exhibit antagonistic properties. IL-6 induces signaling through a cell surface heterodimeric receptor complex composed of a ligand-binding subunit (IL-6 R alpha) and a signal-transducing subunit (gp130). IL-6 binds to IL-6 R alpha, triggering IL-6 R alpha association with gp130 and gp130 dimerization. Gp130 is also a component of the receptors for CLC, CNTF, CT-1, IL-11, IL-27, LIF, and OSM. Soluble forms of IL-6 R alpha are generated by both alternative splicing and proteolytic cleavage. In a mechanism known as trans-signaling, complexes of soluble IL-6 and IL-6 R alpha elicit responses from gp130-expressing cells that lack cell surface IL-6 R alpha. Trans-signaling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R alpha is predominantly restricted to hepatocytes, monocytes, and resting lymphocytes. Soluble splice forms of gp130 block trans-signaling from IL-6/IL-6 R alpha but not from other cytokines that use gp130 as a co-receptor. IL-6, along with TNF-alpha and IL-1, drives the acute inflammatory response and the transition from acute inflammation to either acquired immunity or chronic inflammatory disease. When dysregulated, it contributes to chronic inflammation in obesity, insulin resistance, inflammatory bowel disease, arthritis, sepsis, and atherosclerosis. IL-6 can also function as an anti-inflammatory molecule, as in skeletal muscle where it is secreted in response to exercise. In addition, it enhances hematopoietic stem cell proliferation and the differentiation of Th17 cells, memory B cells, and plasma cells.

Specifications

Product Name

Recombinant Human IL-6 Protein, >95% (SDS-PAGE)

Synonyms

Interleukin BSF 2 | B cell differentiation factor | B cell stimulatory factor 2 | B-cell stimulatory factor 2 | BSF 2 | BSF-2 | BSF2 | CDF | CTL differentiation factor | Cytotoxic T cell differentiation factor | Hepatocyte stimulatory factor | Hepatocyte

Grade

ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only

Specifications & Purity

Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)

Purity

>95% (SDS-PAGE)

Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.123 ng/mL. Immobilized Recombinant Human IL-6 Protein (rp156005) at 1.0 μg/mL can bind MEDI-5117 (anti-IL-6) (Ab182698) with the EC50 of 13.84 ng/mL.

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Amino Acids

30-212 aa

Sequence

MGSSHHHHHHSSGLVPRGSHMVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Protein Tag

N-His

Accession #

P05231

Predicted molecular weight

23.1 kDa

SDS-PAGE

24.1 kDa, under reducing condition

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Images

Protein Bioactivity: Recombinant Human IL-6 Protein (rp156005)

Recombinant Human IL-6 Protein (rp156005) - Protein Bioactivity
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.123 ng/mL.

SDS-PAGE: Recombinant Human IL-6 Protein (rp156005)

Recombinant Human IL-6 Protein (rp156005) - SDS-PAGE
3 μg/lane of Recombinant Human IL-6 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 24.1 kDa.