Recombinant Human S100A4 Protein

Cat. No.: rp183701
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P26447
Protein Tag
C-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
Size
USA
Germany (EU)*
Price
Qty
10μg
rp183701-10μg
7 In stock
$113.90
50μg
rp183701-50μg
3 In stock
$339.90
100μg
rp183701-100μg
7 In stock
$539.90
1mg
rp183701-1mg
US Made to order · 2–4 wks ·
$2,849.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His-Tag,≥95%(SDS-PAGE) Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

S100A4, also known as metastasis-associated protein Mtsl, belongs to the family of small calcium-binding S100 proteins containing two EF-hand calcium-binding motifs. In humans at least 20 S100 family members that are distributed tissue specifically have been identified, and are involved in a number of cellular processes as transducers of calcium signal. S100A4 is a symmetric homodimer, and undergoes a relatively large conformational change upon the typical EF-hand binding calcium, which is necessary for S100A4 to interact with its protein targets and generate biological effects. It can bind the already known targets p53, F-actin, liprin β, myosin heavy chain II, and prevent their phosphorylation and multimerization. It has been demonstrated that S100A4 is directly involved in tumor metastasis including cell motility, invasion, apoptosis, angiogenesis and differentiation, and appears to be a metastasis factor and a molecular marker for clinical prognosis. Multiple alternatively spliced variants encoding the same protein have been identified. 

Specifications

Product Name
Recombinant Human S100A4 Protein
Synonyms
18A2 | 42A | Calvasculin | CAPL | CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin | fibroblast-specific protein-1, 42A | FSP1 | leukemia multidrug resistance associated protein | malignant transformation suppression 1 | Metast
Grade
Carrier Free, His Tag
Specifications & Purity
Carrier Free, His-Tag, ≥95%(SDS-PAGE)
Bioactivity
Testing in progress
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
1-101 aa
Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKKHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
12.5 kDa
SDS-PAGE
11.4 kDa, under reducing conditions; 11.4 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human S100A4 Protein (rp183701) - SDS-PAGE
3 μg/lane of Recombinant Human S100A4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 11.4 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0809710Certificate of AnalysisMar 16, 2026 rp183701
ZJ24F0809711Certificate of AnalysisMar 16, 2026 rp183701
ZJ24F0809712Certificate of AnalysisMar 16, 2026 rp183701
ZJ24R0800890Certificate of AnalysisAug 09, 2024 rp183701
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.