Recombinant Human TROP-2 Protein

Cat. No.: rp176296
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P09758
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED50 for this effect is 0.72 μg/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp176296-10μg
≥10
$99.90
50μg
rp176296-50μg
10
$279.90
100μg
rp176296-100μg
8
$439.90
1mg
rp176296-1mg
1
$2,599.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
TROP-2, also referred to as tumor-associated calcium signal transducer 2 (TACSTD2), GA733-1 or M1S1, is a cell surface glycoprotein highly expressed in a wide variety of epithelial cancers. In contrast, there is little or no expression of Trop-2 in adult somatic tissue. Because it is a cell surface protein that is selectively expressed in tumor cells, Trop-2 is a potential therapeutic target. The cytoplasmic tail of Trop-2 possesses potential serine and tyrosine phosphorylation sites and a phosphatidyl-inositol binding consensus sequence. Trop-2 transduces an intracellular calcium signal, which are consistent with the hypothesis that it acts as a cell surface receptor and support a search for a physiological ligand. TROP2 encoding by an intronless gene was originally defined by the monoclonal antibody GA733, and is a member of a family of at least two type I membrane proteins. The other known member is GA733-2, also called EpCAM and TROP1. It has been suggested by studies that the GA733-1 gene was formed by the retroposition of the GA733-2 gene via an mRNA intermediate.

Specifications

Product Name
Recombinant Human TROP-2 Protein
Synonyms
Pancreatic carcinoma marker protein GA7331 | TACD 2 | TACD2_HUMAN | TACSTD 2 | Tacstd2 | Trop 2 | Trop2 | Tumor associated calcium signal transducer 2 precursor | Tumor-associated calcium signal transducer 2 | Cell surface glycoprotein Trop 2 | Cell surfa
Grade
Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED50 for this effect is 0.72 μg/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-274 aa
Sequence
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTHHHHHH
Protein Tag
C-His
N-terminal Sequence
His27
Accession #
Predicted molecular weight
28.7 kDa
SDS-PAGE
38.5-49.9 kDa, under reducing conditions; 36.5-48.5 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human TROP-2 Protein (rp176296) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED₅₀ for this effect is 0.72 μg/mL.

Recombinant Human TROP-2 Protein (rp176296) - SDS-PAGE
3 μg/lane of Recombinant Human TROP-2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 38.5-49.9 kDa under reducing conditions and 36.5-48.5 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeDateItem
ZJ24F0505933Certificate of AnalysisMay 24, 2024 rp176296
ZJ24F0505932Certificate of AnalysisMay 24, 2024 rp176296
ZJ24F0505931Certificate of AnalysisMay 24, 2024 rp176296
ZJ24F0505930Certificate of AnalysisMay 24, 2024 rp176296
ZJ24R0400484Certificate of AnalysisApr 29, 2024 rp176296
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.