Recombinant Human TSLP Protein, >95%(SDS-PAGE)

Cat. No.: rp169653
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q969D9
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human TSLP Protein (rp169653) at 2.0 μg/mL can bind Tezepelumab (anti-TSLP) (Ab170833) with the EC50 of 18.04 ng/mL.
Size
USA
Germany (EU)*
Price
Qty
10μg
rp169653-10μg
5 In stock
$219.90
50μg
rp169653-50μg
4 In stock
$399.90
100μg
rp169653-100μg
1 In stock
$579.90
1mg
rp169653-1mg
US Made to order · 2–4 wks ·
$3,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Azide Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Thymic stromal lymphopoietin (TSLP) is an interleukin 7 (IL-7)-like cytokine originally characterized by its ability to promote the activation of B cells and dendritic cells (DCs). Thymic stromal lymphopoietin (TSLP) is a cytokine expressed by epithelial cells, including keratinocytes, and is important in allergic inflammation. Subsequent studies have shown that TSLP promotes T helper type 2 (TH2) cell responses associated with immunity to some helminth parasites and the pathogenesis of many inflammatory diseases, including atopic dermatitis and asthma. TSLP can promote TH2 cytokine-associated inflammation by directly promoting the effector functions of CD4+ TH2 cells, basophils and other granulocyte populations while simultaneously limiting the expression of DC-derived proinflammatory cytokines and promoting regulatory T cell responses in peripheral tissues.

Specifications

Product Name
Recombinant Human TSLP Protein, >95%(SDS-PAGE)
Synonyms
thymic stromal lymphopoietin | TSLP | Thymic stromal lymphopoietin protein TSLP | TSLP protein | TSLP_HUMAN | EC 1.3.5.1 | Ip | Iron-sulfur subunit of complex II
Grade
ActiBioPure™, Azide Free, Bioactive, Carrier Free, His Tag
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, Azide Free, His-Tag, ≥95%(SDS-PAGE)
Purity
>95%(SDS-PAGE)
Bioactivity
Immobilized Recombinant Human TSLP Protein (rp169653) at 2.0 μg/mL can bind Tezepelumab (anti-TSLP) (Ab170833) with the EC50 of 18.04 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
29-159 aa
Sequence
MGSSHHHHHHSSGLVPRGSYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Protein Tag
N-His
Accession #
Predicted molecular weight
17.0 kDa
SDS-PAGE
15.4 kDa, reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Transparent gelatinous
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human TSLP Protein (rp169653) - SDS-PAGE
Recombinant Human TSLP Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 15.4 kDa.

Recombinant Human TSLP Protein (rp169653) - ELISA
Immobilized Recombinant Human TSLP Protein (rp169653) at 2.0 μg/mL can bind Tezepelumab (anti-TSLP) (Ab170833) with the EC₅₀ of 18.04 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

7 results found

Lot NumberCertificate TypeDateItem
ZJ23F1101771Certificate of AnalysisApr 09, 2026 rp169653
ZJ23F1101772Certificate of AnalysisApr 09, 2026 rp169653
ZJ23F1101773Certificate of AnalysisApr 09, 2026 rp169653
ZJ25F1129641Certificate of AnalysisNov 21, 2025 rp169653
ZJ25F1129640Certificate of AnalysisNov 21, 2025 rp169653
ZJ25F1129642Certificate of AnalysisNov 21, 2025 rp169653
ZJ23R1100152Certificate of AnalysisNov 15, 2023 rp169653
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.