Recombinant Human CCL17/TARC Protein

Cat. No.: rp170428

GRADE & PURITY Carrier Free, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

Q92583

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Overview

Chemokines are a family of small chemotactic cytokines, or proteins secreted by cells. Chemokines share the same structure similarities such as small size, and the presence of four cysteine residues in conserved locations in order to form their 3-dimensional shape. Some of the chemokines are considered pro-inflammatory which can be induced to recruit cells of the immune system to a site of infection during an immune response, while others are considered homeostatic and are implied in controlling the migration of cells during normal processes of tissue maintenance and development. There are four members of the chemokine family: C-C kemokines, C kemokines, CXC kemokines and CX3C kemokines. The C-C kemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands-1 to 28. Chemokin ligand 17 (CCL17), also known as thymus and activation regulated chemokine(TARC), is a small cytokine belonging to the C-C chemokine family. CCL17 is expressed maily in thymus and transiently in phytohemagglutinin-stimulated peripheral blood mononuclear cells. CCL17 can induce chemotaxis in T cells by binding with the chemokine receptor CCR4. 

Specifications

Product Name

Recombinant Human CCL17/TARC Protein

Synonyms

ABCD-2 | CC chemokine TARC | C-C motif chemokine 17 | CCL17 | chemokine (C-C motif) ligand 17 | MGC138273 | SCYA17 | SCYA17MGC138271 | small inducible cytokine subfamily A (Cys-Cys), member 17 | Small-inducible cytokine A17 | T cell-directed CC chemokine

Grade

Carrier Free

Specifications & Purity

Carrier Free, ≥95%(SDS-PAGE)

Bioactivity

Testing in progress

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Amino Acids

24-94 aa

Sequence

GARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS​

Protein Tag

No tag

Accession #

Q92583

Predicted molecular weight

8.1 kDa

SDS-PAGE

10.4 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions

Molecule Type

Protein

Storage and Shipping

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human CCL17/TARC Protein (rp170428)

Recombinant Human CCL17/TARC Protein (rp170428) - SDS-PAGE
1 μg/lane of Recombinant Human CCL17/TARC Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.4 kDa under reducing conditions and 11.3 kDa under non-reducing conditions.