Recombinant Human M-CSF Protein

Cat. No.: rp156168
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE) See COA
Accession #
P09603
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 21.77 ng/mL. Immobilized Recombinant Human M-CSF Protein (rp215098) at 1.0 μg/mL can bind Lacnotuzumab (anti-M-CSF) (Ab177849) with the EC50 of 37.0 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp156168-10μg
7
$177.90
50μg
rp156168-50μg
3
$531.90
100μg
rp156168-100μg
3
$851.90
1mg
rp156168-1mg
1
$3,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human M-CSF Protein
Synonyms
colony stimulating factor 1 (macrophage) | CSF1 | CSF-1 | Lanimostim | macrophage colony stimulating factor | macrophage colony-stimulating factor 1 | MCSF | M-CSF | MCSFlanimostim | MGC31930
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms
M-CSF, also known as CSF-1, is a four-alpha-helical-bundle cytokine that is the primary regulator of macrophage survival, proliferation, and differentiation. M-CSF is also essential for the survival and proliferation of osteoclast progenitors. It primes a
Bioactivity
Measured in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 21.77 ng/mL. Immobilized Recombinant Human M-CSF Protein (rp215098) at 1.0 μg/mL can bind Lacnotuzumab (anti-M-CSF) (Ab177849) with the EC50 of 37.0 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
1-255 aa
Sequence
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRHHHHHH
Accession #
Predicted molecular weight
26.0 kDa
SDS-PAGE
33.4-50.6 kDa, under reducing conditions; 89.7-101.6 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Images

Recombinant Human M-CSF Protein (rp156168) - ELISA
Immobilized Recombinant Human M-CSF Protein (rp156168) at 1.0 μg/mL can bind Lacnotuzumab (anti-M-CSF) (Ab177849) with the EC₅₀ of 37.0 ng/mL.

Recombinant Human M-CSF protein (rp156168) - SDS-PAGE
3 μg/lane of Recombinant Human M-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 33.4-50.6 kDa under reducing conditions and 89.7-101.6 kDa under non-reducing conditions.


Recombinant Human M-CSF Protein (rp156168) - ELISA
Measured in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 21.77 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ25F0319635Certificate of AnalysisFeb 24, 2026 rp156168
ZJ25F0319636Certificate of AnalysisFeb 24, 2026 rp156168
ZJ25F0319637Certificate of AnalysisFeb 24, 2026 rp156168
ZJ25F0319638Certificate of AnalysisFeb 24, 2026 rp156168
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.