Recombinant Feline CD16 Protein, >95% (SDS-PAGE)

Cat. No.: rp176261
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q9N2I5
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp176261-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$119.90
50μg
rp176261-50μg
1
$419.90
100μg
rp176261-100μg
1
$559.90
1mg
rp176261-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,399.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Azide Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent cellular cytotoxicity (ADCC). Does not bind free monomeric IgG, thus avoiding inappropriate effector cell activation in the absence of antigenic trigger (By similarity).
Mediates IgG effector functions on natural killer (NK) cells. Binds antigen-IgG complexes generated upon infection and triggers NK cell-dependent cytokine production and degranulation to limit viral load and propagation (By similarity).
Fc-binding subunit that associates with FCER1G adapter to form functional signaling complexes. Following the engagement of antigen-IgG complexes, triggers phosphorylation of immunoreceptor tyrosine-based activation motif (ITAM)-containing adapter with subsequent activation of phosphatidylinositol 3-kinase signaling and sustained elevation of intracellular calcium that ultimately drive NK cell activation (By similarity).
Mediates enhanced ADCC in response to afucosylated IgGs (By similarity).

Specifications

Product Name
Recombinant Feline CD16 Protein, >95% (SDS-PAGE)
Synonyms
D 16 | CD 16a | CD16 | CD16a | CD16a antigen | CD16B | CD16b antigen | Fc fragment of IgG | Fc fragment of IgG low affinity IIIa receptor | Fc fragment of IgG low affinity IIIa receptor (CD16) | Fc fragment of IgG receptor IIIa | Fc fragment of IgG, low a
Grade
Animal Free, Azide Free, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Purity
>95% (SDS-PAGE)
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
21-207 aa
Sequence
ADLSKAMVVLEPEWNRVLVSDGVILKCEGAYPPGDNSAQWWHNGSVIPHRAPSYSIEAARSEDSGEYKCQTGLSEASDPVQLEVHTGWLLLQAPRWVFQEGDTIQLRCHSWKNKTVQKVQYFQDGRGKMFFHKNSDFYIPKATSKHSGSYFCRGLIGNKNESSEAVNITVQGPPVPSTSTFLPHWYQHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
21.9 kDa
SDS-PAGE
29.6-46.9 kDa, under reducing conditions; 26.8-43.1 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Feline CD16 Protein (rp176261) - SDS-PAGE
3 μg/lane of Recombinant Feline CD16 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 29.6-46.9 kDa under reducing conditions and 26.8-43.1 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

7 results found

Lot NumberCertificate TypeDateItem
ZJ24F0202909Certificate of AnalysisJun 22, 2026 rp176261
ZJ24F0202910Certificate of AnalysisJun 22, 2026 rp176261
ZJ24F0202911Certificate of AnalysisJun 22, 2026 rp176261
ZJ26F0333646Certificate of AnalysisApr 01, 2026 rp176261
ZJ26F0333645Certificate of AnalysisApr 01, 2026 rp176261
ZJ26F0333644Certificate of AnalysisApr 01, 2026 rp176261
ZJ24R0200291Certificate of AnalysisFeb 22, 2024 rp176261
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.