Recombinant Human CD5 Protein

Cat. No.: rp176727
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
P06127
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human CD5 Protein (rp176727) at 1.0 μg/mL can bind CD5 Mouse mAb (Ab006673) with the EC50 of 11.62 ng/mL.
Size
USA
Germany (EU)*
Price
Qty
10μg
rp176727-10μg
7 In stock
$139.90
50μg
rp176727-50μg
7 In stock
$399.90
100μg
rp176727-100μg
6 In stock
$639.90
1mg
rp176727-1mg
US Made to order · 2–4 wks ·
$4,899.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. CD5 is a member of the CD system. CD5 was found to be widely distributed in T-cells and B1 cells which is a subset of IgM-secreting B cells. CD5 also was found expressed in small lymphocytic lymphoma, hairy cell leukaemia and mantle cell lymphoma cells. CD5 serves to weaken the activating stimulus from the BCR so that the B1 cells can only reflect to the very strong stimuli but not the normal tissue proteins. 

Specifications

Product Name
Recombinant Human CD5 Protein
Synonyms
CD5 antigen | CD5 antigen (p56-62) | CD5 molecule | CD5 | LEU1T-cell surface glycoprotein CD5 | Lymphocyte antigen T1/Leu-1 | T1
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE)
Bioactivity
Immobilized Recombinant Human CD5 Protein (rp176727) at 1.0 μg/mL can bind CD5 Mouse mAb (Ab006673) with the EC50 of 11.62 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-372 aa
Sequence
MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPHHHHHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
42.3 kDa
SDS-PAGE
51.9 kDa, under reducing conditions; 48.0 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human CD5 Protein (rp176727) - ELISA
Immobilized Recombinant Human CD5 Protein (rp176727) at 1.0 μg/mL can bind CD5 Mouse mAb (Ab006673) with the EC50 of 11.62 ng/mL.

Recombinant Human CD5 Protein (rp176727) - SDS-PAGE
3 μg/lane of Recombinant Human CD5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 51.9 kDa under reducing conditions and 48.0 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0809485Certificate of AnalysisMar 13, 2026 rp176727
ZJ24F0809486Certificate of AnalysisMar 13, 2026 rp176727
ZJ24F0809487Certificate of AnalysisMar 13, 2026 rp176727
ZJ24R0800863Certificate of AnalysisAug 02, 2024 rp176727
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.