Recombinant Human CD68 Protein

Cat. No.: rp175904
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Accession #
P34810
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Size
USA
Germany (EU)*
Price
Qty
10μg
rp175904-10μg
In stock ≥10
$139.90
50μg
rp175904-50μg
2 In stock
$399.90
100μg
rp175904-100μg
2 In stock
$699.90
1mg
rp175904-1mg
US Made to order · 2–4 wks ·
$4,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥90%(SDS-PAGE) Animal Free,Azide Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Macrosialin, also known as CD68 and Gp11, is a single-pass type I membrane protein which belongs to theLAMP family. CD68 is highly expressed by blood monocytes and tissue macrophages. It is also expressed in lymphocytes, fibroblasts and endothelial cells. CD68 is expressed in many tumor cell lines which could allow them to attach to selectins on vascular endothelium, facilitating their dissemination to secondary sites. CD68 plays a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. It is a commonly used marker for macrophages. However, a number of studies have shown that CD68 antibodies react with other hematopoietic and non-hematopoietic cell types, suggesting that CD68 may not be a macrophage-specific antigen. CD68 binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells.

Specifications

Product Name
Recombinant Human CD68 Protein
Synonyms
CD_antigen: CD68 | CD68 antigen | CD68 molecule | CD68 | DKFZp686M18236 | gp110 | LAMP4 | macrophage antigen CD68 | Macrosialin | SCARD1 | SRD1 | scavenger receptor class D, member 1 | SR-D1 | CD 68 | CD68_HUMAN
Grade
Animal Free, Azide Free, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥90%(SDS-PAGE)
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
22-319 aa
Sequence
NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
32.4 kDa
SDS-PAGE
72.9-125.0 kDa, under reducing conditions; 72.9-125.0 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human CD68 Protein (rp175904) - SDS-PAGE
3 μg/lane of Recombinant Human CD68 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 72.9-125.0 kDa under reducing conditions and 72.9-125.0 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0303309Certificate of AnalysisAug 08, 2026 rp175904
ZJ24F0303310Certificate of AnalysisAug 08, 2026 rp175904
ZJ24F0303311Certificate of AnalysisAug 08, 2026 rp175904
ZJ24R0300322Certificate of AnalysisMar 08, 2024 rp175904
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.