Recombinant Human Estrogen Receptor beta Protein

Cat. No.: rp183732
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q92731
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp183732-10μg
≥10
$127.90
100μg
rp183732-100μg
10
$799.90
1mg
rp183732-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,399.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His-Tag,≥95%(SDS-PAGE) Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
ER beta/ESR2, a nuclear hormone receptor, exhibits estrogen-binding capabilities comparable to those of ESR1/ER-alpha and, in turn, triggers the expression of reporter genes harboring estrogen response elements (ERE) in an estrogen-dependent fashion. However, it is noteworthy that ER beta/ESR2 lacks intrinsic ligand binding ability and displays either no or minimal ERE binding activity, resulting in the attenuation or loss of ligand-dependent transactivation capacity. This dual nature, where it can bind estrogens but lacks the typical ligand-dependent activation potential, underscores its distinct regulatory role and highlights its contribution to the intricate network of estrogen-mediated signaling pathways.

Specifications

Product Name
Recombinant Human Estrogen Receptor beta Protein
Synonyms
Estrogen receptor 2 | estrogen receptor 2 (ER beta) | Estrogen receptor beta | estrogen receptor beta 4 | NR3A2 | Nuclear receptor subfamily 3 group A member 2 | ER BETA | ER-beta | Erb | ESR B | ESR BETA | ESR2 | ESR2_HUMAN | ESRB | ESTRB | estrogen nucl
Grade
Carrier Free, His Tag
Specifications & Purity
Carrier Free, His-Tag, ≥95%(SDS-PAGE)
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
2-318 aa
Sequence
MHHHHHHDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPG
Protein Tag
N-His
Accession #
Predicted molecular weight
36.2 kDa
SDS-PAGE
37.5 kDa, under reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human Estrogen Receptor beta Protein (rp183732) - SDS-PAGE
3 μg/lane of Recombinant Human Estrogen Receptor beta Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 37.5 kDa under reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeDateItem
ZJ24F0606779Certificate of AnalysisJun 14, 2024 rp183732
ZJ24F0606778Certificate of AnalysisJun 14, 2024 rp183732
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.