Recombinant Human IL-12 Protein, > 95% (SDS-PAGE)

Cat. No.: rp147384
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE)
Expression System
CHO
Accession #
P29460,P29459
Protein Tag
No tag
Expression system
CHO
Endotoxin Concentration
<0.01 EU/μg
Bioactivity
Recombinant human IL-12 bioactivity is measured in a cell proliferation assay using PHA-P-activated human peripheral blood mononuclear cell (PBMC), the ED₅₀ for this effect is less than 0.04654 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp147384-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$219.90
20μg
rp147384-20μg
1
$319.90
50μg
rp147384-50μg
1
$599.90
100μg
rp147384-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,099.90
1mg
rp147384-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$5,339.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity

>95% SDS-PAGE.


Function

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.


Background

Interleukin-12 (IL-12) is a heterodimeric cytokine of 70 kDa(p70 protein) comprising two covalently linked subunits p35 (35 kDa) alpha (α) chain and the p40 (40 kDa) beta (β) chain. The p40 chain is overproduced relative to the p35 chain and forms homodimers that bind to the IL-12 receptor, competing with the bioactive p70 heterodimer for receptor occupancy and thereby serving as a receptor antagonist. IL-12 is predominantly produced by activated dendritic cells (DCs), macrophages, and neutrophils during T-cell priming and acts directly on cytotoxic immune effector cells, including natural killer (NK) cells, natural killer T (NKT) cells, and CD8+ T cells, to stimulate their proliferation and increase their cytotoxic functions. IL-12 is widely accepted as an important regulator of Th1 responses. It also promotes the expansion and survival of activated T-cells and NK cells and modulates the cytotoxic activity of CTLs and NK cells. During the adaptive immune response, IL-12 primes antigen-specific T-cells for high IFN-g production (driving their differentiation toward the Th-1 pathway). IL-12 can also act as an adjuvant for humoral immunity by enhancing production of IgG2a and IgG2b antibodies. Recombinant human IL-12 is a 69-75kDa isodimer glycoprotein (total of 503 amino acid residues) composed of 35 kDa (p35) and 40 kDa (p40) subunits linked by disulfide bonds. 



Specifications

Product Name
Recombinant Human IL-12 Protein, > 95% (SDS-PAGE)
Synonyms
CLMF | CLMF p35 | CLMF p40 | CLMF1 | Cytotoxic lymphocyte maturation factor 35 kDa subunit | IL-12 subunit p35 | IL12 | IL-12 | IL-12, subunit p35 | IL12A | interleukin 12, p35 | interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphoc
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Specifications & Purity
ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
Purity
> 95% (SDS-PAGE)
Bioactivity
Recombinant human IL-12 bioactivity is measured in a cell proliferation assay using PHA-P-activated human peripheral blood mononuclear cell (PBMC), the ED₅₀ for this effect is less than 0.04654 ng/mL.
Endotoxin Concentration
<0.01 EU/μg
Expression System
CHO
Species
Human
Amino Acids
Human IL-12 p40 (Ile23-Ser328) +Linker(GSGSSRGGSGSGGSGGGGSK)+ Human IL-12 p35 (Arg23-Ser219)
Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS GSGSSRGGSGSGGSGGSGGGGSK RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Protein Tag
No tag
N-terminal Sequence
Ile23
Accession #
Predicted molecular weight
59 kDa (p40-Linker-p35)
SDS-PAGE
69.8 kDa, under reducing conditions; 61.8 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute to a concentration of 0.1-1.0 mg/mL in sterile distilled H2O. Stock solutions should be apportioned into working aliquots and stored at-20 ℃ to -70 ℃. Further dilutions should be made in appropriate buffered solutions. Do not reconstitute in cell culture media directly.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Upon receipt, it is recommended to aliquot. Store at -20°C, Avoid freeze / thaw cycles. Lyophilized with no additives. This product is an active protein and may elicit a biological response in vivo, handle with caution.
Images

Recombinant Human IL-12 Protein (rp147384) - Protein Bioactivity
Recombinant human IL-12 bioactivity is measured in a cell proliferation assay using PHA-P-activated human peripheral blood mononuclear cell (PBMC), the ED₅₀ for this effect is less than 0.04654 ng/mL.

Recombinant Human IL-12 Protein (rp147384) - SDS-PAGE
2.5μg/lane of Recombinant Human IL-12 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 69.8 kDa under reducing conditions and 61.8 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeDateItem
ZJ23F0700640Certificate of AnalysisDec 16, 2025 rp147384
ZJ23F0700641Certificate of AnalysisDec 16, 2025 rp147384
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.