Recombinant Human IL-12 Protein, >90% (SDS-PAGE)

Cat. No.: rp184356
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
P29460,P29459
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured in a cell proliferation assay using PHA-stimulated human T lymphoblasts. The ED50 for this effect is 0.01-0.05 ng/mL. Immobilized Recombinant Human IL-12 protein (rp156174) at 1.0 μg/mL can bind Ebdarokimab (anti-IL-12B) (Ab182919) with the EC50 of 9.68 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp184356-10μg
≥10
$139.90
50μg
rp184356-50μg
3
$599.90
100μg
rp184356-100μg
2
$999.90
1mg
rp184356-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$4,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His Tag,PBS Only,≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
IL12 is a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. It is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit and a 35 kD subunit. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. IL12 has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Recombinant human IL12 protein, fused to His-tag at C-terminus, was expressed in insect cells using baculovirus expression system and purified by using conventional chromatography techniques.

Specifications

Product Name
Recombinant Human IL-12 Protein, >90% (SDS-PAGE)
Synonyms
CLMF Protein | CLMF2 Protein | IL-12B Protein | NKSF Protein | NKSF2 Protein | p40 Protein | Il12p40 Protein | Il-12p40 Protein | Il12 Protein | IL-12 Protein | LOC100217488 Protein | IL-12p35 Protein | Il-12a Protein | Ll12a Protein | p35 Protein | IL12B
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, PBS Only, ≥90%(SDS-PAGE)
Purity
>90% (SDS-PAGE)
Bioactivity
Measured in a cell proliferation assay using PHA-stimulated human T lymphoblasts. The ED50 for this effect is 0.01-0.05 ng/mL. Immobilized Recombinant Human IL-12 protein (rp156174) at 1.0 μg/mL can bind Ebdarokimab (anti-IL-12B) (Ab182919) with the EC50 of 9.68 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-219 aa & 1-328 aa
Sequence
IL-12A: MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASEDLYFQSHHHHHH IL-12B: MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSEDLYFQSHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
60.6 kDa (24.2 kDa + 36.4 kDa)
SDS-PAGE
35-45 kDa, under reducing conditions; 28-40 & 55-69 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human IL-12 Protein (rp184356) - Protein Bioactivity
Measured in a cell proliferation assay using PHA-stimulated human T lymphoblasts. The ED₅₀ for this effect is 0.01-0.05 ng/mL.

Recombinant Human IL-12 Protein (rp184356) - SDS-PAGE
3 μg/lane of Recombinant Human IL-12 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 35-45 kDa under reducing conditions and 28-42 & 45-70 kDa under non-reducing conditions.

Recombinant Human IL-12 Protein (rp184356) - ELISA
Immobilized Recombinant Human IL-12 protein (rp156174) at 1.0 μg/mL can bind Ebdarokimab (anti-IL-12B) (Ab182919) with the EC₅₀ of 9.68 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0303498Certificate of AnalysisMar 22, 2024 rp184356
ZJ24F0303499Certificate of AnalysisMar 22, 2024 rp184356
ZJ24F0303500Certificate of AnalysisMar 22, 2024 rp184356
ZJ24R0300332Certificate of AnalysisMar 15, 2024 rp184356
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.