Recombinant Human IL-36Ra/IL-1F5 Protein

Cat. No.: rp169668

GRADE & PURITY Carrier Free, Azide Free, PBS Only, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

Q9UBH0

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Overview

Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Human interleukin-36 receptor antagonist [IL-36Ra; previously IL-1F5 and also named FIL-1δ (delta), IL1HY1, IL1H3, and IL-1L1] is a member of the IL1 family of proteins. IL1 family members include IL-1 beta, IL-1 alpha, IL-1ra, IL18 and IL-1F5-F10. All family members show a 12 beta -strand, beta -trefoil configuration, and all family members are believed to have arisen from a common ancestral gene that underwent multiple duplications. The human IL36Ra/IL1F5 gene is in closest proximity to the gene for IL-1ra and is likely a relatively recent duplication of the IL-1ra gene. IL-36Ra/IL-1F5 is synthesized as a 155 amino acid (aa) protein that contains no signal sequence, no prosegment and no potential N-linked glycosylation site(s). Nevertheless, it appears to be secreted as a 17 kDa monomer. There is an alternate start site that potentially gives rise to an alternate splice form. The translated product, however, has a premature stop codon, resulting in a truncated 16 aa peptide. Human to mouse, full-length IL-1F5 has 90% aa identity. Within the family, IL-36Ra/IL-1F5 is 50% aa identical to IL-1ra, and 32%, 31%, 35%, 37%, 32% and 42% aa identical to IL-1 beta, IL-36 alpha /IL1F6, IL37/IL1F7, IL36 beta /IL1F8, IL36 gamma /IL1F9 and IL1F10, respectively. Cells reported to express IL36Ra/IL-1F5 include monocytes, B cells, dendritic cells/Langerhans cells, keratinocytes, and gastric fundus Parietal and Chief cells. The receptor for IL-36Ra/IL-1F5 has not been positively identified. Indirect evidence suggests it is IL-1 Rrp2 and/or IL-1 RAcP. In either case, activity association with receptor binding is also unclear. It was initially reported to be an antagonist of IL36 gamma /IL1F9 activity. This would be consistent with its hypothesized relationship to IL1ra. Studies, however, find IL-36Ra/IL-1F5 antagonist activity difficult to demonstrate.

Specifications

Product Name

Recombinant Human IL-36Ra/IL-1F5 Protein

Synonyms

interleukin 1 family, member 5 (delta) | interleukin 1, delta | Interleukin 36 Receptor Antagonist | interleukin-1 family member 5 | Interleukin-1 receptor antagonist homolog 1 | Interleukin-1-like protein 1 | Interleukin-36 Receptor Antagonist | Interleu

Grade

Azide Free, Carrier Free, PBS Only

Specifications & Purity

Carrier Free, Azide Free, PBS Only, ≥95%(SDS-PAGE)

Bioactivity

Testing in progress

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Amino Acids

2-155 aa

Sequence

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Protein Tag

No tag

Accession #

Q9UBH0

Predicted molecular weight

16.8 kDa

SDS-PAGE

14.2 kDa,  under reducing conditions; 14.0 &14.3 kDa,  under reducing conditions

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human IL-36Ra/IL-1F5 Protein (rp169668)

Recombinant Human IL-36Ra/IL-1F5 Protein (rp169668) - SDS-PAGE
3 μg/lane of Recombinant Human IL-36Ra/IL-1F5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.2 kDa under reducing conditions and 14.0 & 14.3 kDa under non-reducing conditions.