Recombinant Human IL-4R alpha Protein

Cat. No.: rp184044
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
P24394
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its ability to inhibit IL-4 induced proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is typically 42.55 ng/mL in the presence of 20.0 ng/mL of Recombinant Human IL-4 Protein (rp147593).
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp184044-10μg
6
$159.90
50μg
rp184044-50μg
3
$459.90
100μg
rp184044-100μg
3
$729.90
1mg
rp184044-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

$3,914.90

$4,719.90
Save $805.00 (17.06%)
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IL-4R alpha Protein
Synonyms
CD124 | IL 4R alpha | IL-4 receptor subunit alpha | IL-4-binding protein | IL-4R subunit alpha | IL-4R-alpha | IL-4RA | IL4-BP | Il4r | IL4R nirs variant 1 | IL4RA | IL4RA_HUMAN | Interleukin 4 receptor | Interleukin 4 receptor alpha chain | sIL4Ralpha/pr
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production
Bioactivity
Measured by its ability to inhibit IL-4 induced proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is typically 42.55 ng/mL in the presence of 20.0 ng/mL of Recombinant Human IL-4 Protein (rp147593).
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
1-232 aa
Sequence
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHHHHHHH
Accession #
Predicted molecular weight
24.6 kDa
SDS-PAGE
38.1-53.0 kDa, under reducing conditions; 38.1-53.0 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Images

Recombinant Human IL-4R alpha Protein (rp184044) - Protein Bioactivity
Measured by its ability to inhibit IL-4 induced proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is typically 42.55 ng/mL in the presence of 20.0 ng/mL of Recombinant Human IL-4 Protein (rp147593).

Recombinant Human IL-4R alpha Protein (rp184044) - SDS-PAGE
3 μg/lane of Recombinant Human IL-4R alpha Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 38.1-53.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F1113643Certificate of AnalysisJun 15, 2026 rp184044
ZJ24F1113644Certificate of AnalysisJun 15, 2026 rp184044
ZJ24F1113645Certificate of AnalysisJun 15, 2026 rp184044
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.