Recombinant Human TNF-α Protein, >95% (SDS-PAGE)

Cat. No.: rp156007

GRADE & PURITY Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

P01375

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 20-100 pg/mL.

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Tumor necrosis factor alpha (TNF-alpha), also known as cachectin and TNFSF2, is the prototypic ligand of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation, immune system development, apoptosis, and lipid metabolism. Human TNF-alpha consists of a 35 amino acid (aa) cytoplasmic domain, a 21 aa transmembrane segment, and a 177 aa extracellular domain (ECD). Within the ECD, human TNF-alpha shares 97% aa sequence identity with rhesus and 71%-92% with bovine, canine, cotton rat, equine, feline, mouse, porcine, and rat TNF-alpha. TNF-alpha is produced by a wide variety of immune, epithelial, endothelial, and tumor cells. TNF-alpha is assembled intracellularly to form a noncovalently linked homotrimer which is expressed on the cell surface. Cell surface TNF-alpha can induce the lysis of neighboring tumor cells and virus-infected cells, and it can generate its own downstream cell signaling following ligation by soluble TNFR I. Shedding of membrane-bound TNF-alpha by TACE/ADAM17 releases the bioactive cytokine, a 55 kDa soluble trimer of the TNF-alpha extracellular domain. TNF-alpha binds the ubiquitous 55-60 kDa TNF RI and the hematopoietic cell-restricted 80 kDa TNF RII, both of which are also expressed as homotrimers. Both type I and type II receptors bind TNF-alpha with comparable affinity, although only TNF RI contains a cytoplasmic death domain which triggers the activation of apoptosis. Soluble forms of both types of receptors are released and can neutralize the biological activity of TNF-alpha.

Specifications

Product Name

Recombinant Human TNF-α Protein, >95% (SDS-PAGE)

Synonyms

Cachectin | TNF-a | TNF-alpha | Tumor necrosis factor ligand superfamily member 2 | APC1 | APC1 protein | Cachectin | DIF | Differentiation inducing factor | Macrophage cytotoxic factor | Tnf | TNF superfamily member 2 | TNF superfamily, member 2 | TNF, m

Grade

ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only

Specifications & Purity

Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)

Purity

>95% (SDS-PAGE)

Bioactivity

Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 20-100 pg/mL.

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Amino Acids

78-233 aa

Sequence

MGSSHHHHHHSSGLVPRGSHMRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Protein Tag

N-His

Accession #

P01375

Predicted molecular weight

19.5 kDa

SDS-PAGE

17.6 kDa, under reducing conditions；17.6 kDa, under non-reducing condition

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Images

Protein Bioactivity: Recombinant Human TNF-α Protein (rp156007)

Recombinant Human TNF-α Protein (rp156007) - Protein Bioactivity
Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 20-100 pg/mL.

SDS-PAGE: Recombinant Human TNF-α Protein (rp156007)

Recombinant Human TNF-α Protein (rp156007) - SDS-PAGE
1.5 μg/lane of Recombinant Human TNF-α Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 17.6 kDa.