Recombinant Bovine CD64 Protein, >95% (SDS-PAGE)

Cat. No.: rp175924
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q9MZT0
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp175924-10μg
≥10
$99.90
50μg
rp175924-50μg
10
$299.90
100μg
rp175924-100μg
10
$459.90
1mg
rp175924-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,799.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) Animal Free,Azide Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description: High affinity immunoglobulin gamma Fc receptor I, also known as FCGR1 and CD64, is an integral membraneglycoprotein and a member of the immunoglobulin superfamily. CD64 is a high affinity receptor for the Fc region of IgG gamma and functions in both innate and adaptive immune responses. Receptors that recognize the Fc portion of IgG function in the regulation of immune response and are divided into three classes designated CD64, CD32, and CD16. CD64 is structurally composed of asignal peptidethat allows its transport to the surface of a cell, threeextracellularimmunoglobulin domainsof the C2-type that it uses to bind antibody, a hydrophobictransmembrane domain, and a short cytoplasmic tail. CD64 isconstitutivelyfound on only macrophages and monocytes, but treatment of polymorphonuclear leukocyteswith cytokines likeIFNγandG-CSFcan induce CD64 expression on these cells. The inactivation of the mouse CD64 resulted in a wide range of defects in antibody Fc-dependent functions. Mouse CD64 is an early participant in Fc-dependent cell activation and in the development of immune responses.

Specifications

Product Name
Recombinant Bovine CD64 Protein, >95% (SDS-PAGE)
Synonyms
CD64 antigen | CD64 | CD64a | Fc fragment of IgG, high affinity Ia, receptor (CD64) | Fc gamma RI | FCG1 | Fc-gamma receptor I B2 | Fc-gamma RI | Fc-gamma RIA | FcgammaRIa | FcgRI | FCGR1 | FcgRIA | FCRI | FcRIA | FLJ18345 | high affinity Ia, receptor for
Grade
Animal Free, Azide Free, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Purity
>95% (SDS-PAGE)
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-287 aa
Sequence
MWLIIALILGAPVAEQVDPTKAVITLKPPWVSVFQEENVTLLCEGPHRPGDTATQWFLNGTAIKTLAPRYSINSATFDDSGEYKCQTGLSMLSDPVQLEIHSDWLLLQVTSRVFTEGDPLALRCHAWKNMPVYKMLFYKDGKPFRFSSQDSEFTILQTNLSHNGIYHCSGERRRRYTSAGVSITIKELFPAPVLRTSFSSPHQEGNLVNLSCETKLPSEKPGQQLYFSFYVGNKTLISRTTSSEYQTFIAKKEDRRLYWCEAATGDGNLIKRSPELELPVLGLQSTTHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
33.5 kDa
SDS-PAGE
37.7-52.3 kDa, under reducing conditions; 36.7-51.3 kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Bovine CD64 Protein (rp175924) - SDS-PAGE
3 μg/lane of Recombinant Bovine CD64 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 37.7-52.3 kDa under reducing conditions and 36.7-51.3 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeDateItem
ZJ24F0303408Certificate of AnalysisMar 22, 2024 rp175924
ZJ24F0303409Certificate of AnalysisMar 22, 2024 rp175924
ZJ24F0303410Certificate of AnalysisMar 22, 2024 rp175924
ZJ24F0303411Certificate of AnalysisMar 22, 2024 rp175924
ZJ24R0300326Certificate of AnalysisMar 08, 2024 rp175924
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.