Recombinant Human IL-6R alpha Protein

Cat. No.: rp181252
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P08887
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 2.0 μg/mL can bind Recombinant Human IL-6 Protein (rp156005) with the EC50 of 43.35 ng/mL. 2. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Vobarilizumab (anti-IL-6Ra) (Ab175700) with the EC50 of 67.99 ng/mL. 3. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Tocilizumab (anti-IL-6R) (T412004) with the EC50 of 21.05 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp181252-10μg
7
$139.90
50μg
rp181252-50μg
4
$399.90
100μg
rp181252-100μg
4
$699.90
1mg
rp181252-1mg
1
$4,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Protein Function:
The multifunctional factor interleukin 6 (IL-6) exerts its activities through binding to a high-affinity receptor complex consisting of two membrane glycoproteins: an 80 kDa component receptor that binds IL-6 with low affinity (IL-6R alpha ) and a signal-transducing component of 130 kDa (gp130) that does not bind IL-6 by itself, but is required for high-affinity binding of IL-6 by the complex. Both components of the receptor complex, IL-6R alpha and gp130 have been cloned, sequenced, and expressed.
A soluble form of the IL-6R alpha has been found in the urine of healthy adult humans. This soluble receptor apparently arises from proteolytic cleavage of membrane-bound IL-6R alpha. No naturally-occurring mRNA encoding a truncated form of the IL-6R alpha has been reported. Soluble forms of human and murine IL-6R alpha s have been constructed, however, by insertion of termination codons into the regions of the IL-6R alpha cDNAs encoding the external portions of the receptors and prior to the transmembrane domains. These soluble receptors have been expressed in COS-7 and CHO cells and have been shown to bind to IL-6 in solution and to augment the activity of IL-6 as a result of the binding of the IL-6/IL-6R alpha complex to membrane-bound gp130.

Specifications

Product Name
Recombinant Human IL-6R alpha Protein
Synonyms
CD126 antigen | gp80 | IL 6R | IL 6R 1 | IL 6R alpha | IL-6 receptor alpha chain | IL-6 receptor subunit alpha | IL-6R 1 | IL-6R subunit alpha | IL-6R-alpha | IL-6RA | IL6Q | Il6r | CD126 | IL6RA | IL6RA_HUMAN | IL6RQ | Interleukin 6 receptor | interleuki
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactivity
1. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 2.0 μg/mL can bind Recombinant Human IL-6 Protein (rp156005) with the EC50 of 43.35 ng/mL. 2. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Vobarilizumab (anti-IL-6Ra) (Ab175700) with the EC50 of 67.99 ng/mL. 3. Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Tocilizumab (anti-IL-6R) (T412004) with the EC50 of 21.05 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-365 aa
Sequence
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPHHHHHH
Protein Tag
C-His
N-terminal Sequence
Leu20
Accession #
Predicted molecular weight
39.4 kDa
SDS-PAGE
60.0-80.8 kDa, under reducing conditions; 60.0-80.7kDa, under non-reducing conditions
Molecule Type
Protein
Storage and Shipping
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human IL-6R alpha Protein (rp181252) - Binding Activity
Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 2.0 μg/mL can bind Recombinant Human IL-6 Protein (rp156005) with the EC₅₀ of 43.35 ng/mL.

Recombinant Human IL-6R alpha Protein (rp181252) - ELISA
Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Vobarilizumab (anti-IL-6Ra) (Ab175700) with the EC₅₀ of 67.99 ng/mL.


Recombinant Human IL-6R alpha Protein (rp181252) - ELISA
Immobilized Recombinant Human IL-6R alpha Protein (rp181252) at 1.0 μg/mL can bind Tocilizumab (anti-IL-6R) (T412004) with the EC₅₀ of 21.05 ng/mL.

Recombinant Human IL-6R alpha Protein (rp181252) - SDS-PAGE
2 μg/lane of Recombinant Human IL-6R alpha Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 60.0-80.8 kDa under reducing conditions and 60.0-80.7 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0708062Certificate of AnalysisFeb 24, 2026 rp181252
ZJ24F0708063Certificate of AnalysisFeb 24, 2026 rp181252
ZJ24F0708064Certificate of AnalysisFeb 24, 2026 rp181252
ZJ24F0708065Certificate of AnalysisFeb 24, 2026 rp181252
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.