Recombinant Human CD34 Protein, >95% (SDS-PAGE)

Cat. No.: rp156652
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P28906
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized human CD34 (rp156652) at 2.0 μg/mL can bind Mouse CD34 mAb (Ab094638) with the EC₅₀ of 31.41 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp156652-10μg
≥10
$114.90
50μg
rp156652-50μg
10
$309.90
100μg
rp156652-100μg
1
$499.90
1mg
rp156652-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,199.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
CD34 is a 115 kDa glycosylated type I transmembrane protein; it was discovered as a hematopoietic cell-surface antigen. Human CD34 cDNA encodes a 385 amino acid (aa) precursor that contains a 31 aa signal sequence, a 259 aa extracellular domain (ECD), a 21 aa transmembrane sequence, and a 74 aa cytoplasmic domain. Within the ECD, human CD34 shares 55% and 52% aa sequence identity with mouse and rat CD34, respectively. This single-pass sialomucin‑like transmembrane protein is heavily glycosylated and phosphorylated by Protein Kinase C (PKC). CD34 is found on multipotent precursors, bone marrow stromal cells, embryonic fibroblasts, vascular endothelia, as well as some populations of mesenchymal stem cells, and tumor cell lines, and it is a common marker for diverse progenitors. CD34 is involved in the adhesion of stem cells to the bone marrow extracellular matrix or to stromal cells.

Specifications

Product Name
Recombinant Human CD34 Protein, >95% (SDS-PAGE)
Synonyms
CD34 | CD34 antigen | CD34 molecule | CD34_HUMAN | Cluster designation 34 | cluster of differentiation 34 | Hematopoietic progenitor cell antigen CD34 | HPCA1 | Mucosialin | OTTHUMP00000034733 | OTTHUMP00000034734
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, His Tag, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Purity
>95% (SDS-PAGE)
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized human CD34 (rp156652) at 2.0 μg/mL can bind Mouse CD34 mAb (Ab094638) with the EC₅₀ of 31.41 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
HEK293
Amino Acids
1-290 aa
Sequence
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTHHHHHH
Protein Tag
C-His
Accession #
Predicted molecular weight
27.5 kDa
SDS-PAGE
96.5-131.2 kDa, under reducing conditions; 96.5-131.2 kDa, under non-reducing condition
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human CD34 Protein (rp156652) - SDS-PAGE
3 μg/lane of Recombinant Human CD34 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 96.5-131.2 kDa.

Recombinant Human CD34 Protein (rp156652) - ELISA
Measured by its binding ability in a functional ELISA. Immobilized human CD34 (rp156652) at 2.0 μg/mL can bind Mouse CD34 mAb (Ab094638) with the EC₅₀ of 31.41 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0303253Certificate of AnalysisMar 18, 2024 rp156652
ZJ24F0303254Certificate of AnalysisMar 18, 2024 rp156652
ZJ24F0303255Certificate of AnalysisMar 18, 2024 rp156652
ZJ24R0300325Certificate of AnalysisMar 08, 2024 rp156652
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.