Recombinant Human CTGF Protein, >90% (SDS-PAGE)

Cat. No.: rp156664

GRADE & PURITY Carrier Free, Azide Free, His Tag, ≥90%(SDS-PAGE)

Expression System

E. coli

Accession #

P29279

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Overview

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Connective Tissue Growth Factor (CTGF), also known as CCN2, is a 36-38 kDa member of the CCN (CYR61/CTGF/NOV) family of secreted matricellular proteins. Like other CCN proteins, mature human CTGF consists of IGF-binding protein domain, a vWF-C domain, a TSP-1 domain, and a cysteine knot heparin-binding domain. Human CTGF shares 94% amino acid (aa) sequence identity with mouse and rat CTGF. Alternative splicing generates an additional isoform with a 27 aa deletion within the TSP-1 domain. CTGF promotes cell adhesion through interactions with a range of cell surface molecules including heparan sulfate proteoglycans (HSPG), LRPAP, and Integrins alpha M, alpha V beta 3, alpha 6 beta 1, alpha IIb beta 3. It also binds to and regulates signaling through the Wnt receptors LRP6 and Frizzled-8 and the NGF receptors TrkA and NGF R. In addition, CTGF binds directly to BMP-4, TGF-beta 1, TGF-beta 2, and VEGF 165. It blocks BMP-4 and VEGF induced responses but enhances TGF-beta induced responses. Within VEGF complexes, CTGF can be degraded by a variety of proteases, resulting in restoration of angiogenic activity. CTGF promotes fibroblast differentiation from mesenchymal stem cells and their production of type I Collagen and Tenascin C. It promotes chondrocyte proliferation and cartilage matrix synthesis. CTGF is expressed in vascular mural and endothelial cells (EC) during development and promotes pericyte-EC association and angiogenesis. It is expressed in the cerebral cortex and olfactory bulb and plays an important role in nervous system development.

Specifications

Product Name

Recombinant Human CTGF Protein, >90% (SDS-PAGE)

Synonyms

CCN2 | CCN2IGFBP-8 | connective tissue growth factor | CTGF | CTGRP | Fisp12 | HCS24 | Hypertrophic chondrocyte-specific protein 24 | IBP-8 | IGF-binding protein 8 | IGFBP-8 | IGFBP8CCN family member 2 | Insulin-like growth factor-binding protein 8 | MGC1

Grade

Azide Free, Carrier Free, His Tag

Specifications & Purity

Carrier Free, Azide Free, His-Tag, ≥90%(SDS-PAGE)

Purity

>90% (SDS-PAGE)

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Amino Acids

253-349 aa

Sequence

MGHHHHHHGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Protein Tag

N-His

Accession #

P29279

Predicted molecular weight

12.1 kDa

SDS-PAGE

12.0 and 25.7 kDa, under reducing conditions.

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human CTGF Protein (rp156664)

Recombinant Human CTGF Protein (rp156664) - SDS-PAGE
1 μg/lane of Recombinant Human CTGF Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing the band at 12.0 & 25.7 kDa under reducing conditions.