Recombinant Human FGF-21 Protein, >95% (SDS-PAGE)

Cat. No.: rp169669
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q9NSA1
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp169669-10μg
≥10
$99.90
50μg
rp169669-50μg
10
$399.90
100μg
rp169669-100μg
10
$559.90
1mg
rp169669-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) Azide Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Fibroblast growth factor 21 (FGF-21) is a member of the FGF gene family, which currently contains 22 human members. Based on its structure, it is further classified as an FGF19 subfamily member. This subfamily includes FGF-19, -21, and -23. Like all other FGF subfamilies, FGF-19 subfamily members contain a 120 amino acid (aa) core FGF domain that exhibits a beta -trefoil structure. Unlike other FGF subfamilies, FGF-19 subfamily members apparently exhibit poor binding to ECM, resulting in highly diffusible molecules. The c-DNA for FGF-21 predicts a 209 aa polypeptide that contains a 28 aa signal sequence and a 181 aa mature region. Notably, FGF-21, as well as FGF-19 show limited binding to heparin. One potential alternate splice form has been reported. It shows a 43 aa substitution for the C-terminal 12 aa of the standard form. Mature human FGF-21 shows 81% aa identity to mouse FGF-21, and is known to be active on mouse cells. The FGF-19 subfamily is considered endocrine in nature. All three subfamily members impact some aspect of metabolism, all three are induced by a nuclear receptor heterodimer that includes RXR, and all three utilize Klotho family members for signal transduction. FGF-21 is produced by hepatocytes in response to free fatty acid (FFA) stimulation of a PPARa/RXR dimeric complex. This situation occurs clinically during starvation, or following the ingestion of a high-fat/low-carbohydrate diet. Upon FGF-21 secretion, white adipose tissue is induced to release FFAs from triglyceride stores. Once FFAs reach hepatocytes, they are oxidized and reduced to acetyl-CoA. The acetyl-CoA is recombined into 4-carbon ketone bodies (acetoacetate and beta -hydroxybutyrate), released, and transported to peripheral tissues for TCA processing and energy generation.

Specifications

Product Name
Recombinant Human FGF-21 Protein, >95% (SDS-PAGE)
Synonyms
FGF 21 | FGF-21 | Fgf21 | FGF21_HUMAN | FGFL | Fibroblast growth factor 21 | PRO10196 | UNQ3115
Grade
Azide Free, Carrier Free, His Tag, PBS Only
Specifications & Purity
Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Purity
>95% (SDS-PAGE)
Bioactivity
Testing in progress
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
29-209 aa
Sequence
MGSSHHHHHHSSGLVPRGSHMMHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Protein Tag
N-His
Accession #
Predicted molecular weight
21.8 kDa
SDS-PAGE
26.2 kDa, under reducing conditions;25.3 kDa, under non-reducing condition
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human FGF-21 Protein (rp169669) - SDS-PAGE
3 μg/lane of Recombinant Human FGF-21 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.2 kDa under reducing conditions and 25.3 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ24F0404859Certificate of AnalysisDec 16, 2025 rp169669
ZJ24F0404860Certificate of AnalysisDec 16, 2025 rp169669
ZJ24F0404861Certificate of AnalysisDec 16, 2025 rp169669
ZJ24F0404862Certificate of AnalysisDec 16, 2025 rp169669
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.